KEGG   Drosophila persimilis: 6591117Help
Entry
6591117           CDS       T01063                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase H
  KO
K09567  peptidyl-prolyl isomerase H (cyclophilin H) [EC:5.2.1.8]
Organism
dpe  Drosophila persimilis
Pathway
dpe03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6591117
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dpe03041]
    6591117
   03110 Chaperones and folding catalysts [BR:dpe03110]
    6591117
Enzymes [BR:dpe01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     6591117
Spliceosome [BR:dpe03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    6591117
Chaperones and folding catalysts [BR:dpe03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    6591117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 6591117
NCBI-ProteinID: XP_002015498
FlyBase: FBgn0148601
UniProt: B4GC70
Position
Unknown
AA seq 183 aa AA seqDB search
MPNWNQIQSQLRSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPD
GVPIGYKGASFHRVIKDFMIQGGDFVQGDGTGVTCIYGNTFGDENFTLKHDSPGLLAMAN
SGKDTNGCQFFITCAKCNFLDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQC
GQM
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcccaactggaaccaaattcagtcccagctgcgcagctccaacaacccagtcgtattt
ttcgacattgccgtgggcacaaccgaaatcggccgcatgatcttcgagctgtttgctgat
acagtgccgcggacagcagaaaactttcgacaattctgcacaggagagtatcggccagat
ggtgtgcctattggttacaagggcgcaagcttccacagagtaattaaagatttcatgata
caaggcggagactttgtccagggcgatggcaccggcgtcacctgcatctatggcaacaca
tttggcgatgagaactttaccttgaagcacgactcacctggcctgctggccatggccaac
agcggcaaggacaccaatggctgccagttcttcattacctgtgccaaatgcaacttcctt
gatggcaagcatgtggtatttggacgcgtacttgacggcctgctgataatgcgaaagatt
gaaaatgttcccacggggcccaacaacaagcccaagcttccagtgacgatttcgcaatgt
ggacagatgtag

DBGET integrated database retrieval system