KEGG   Drosophila persimilis: 6591836Help
Entry
6591836           CDS       T01063                                 

Definition
(RefSeq) soluble guanylate cyclase 89Da
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
dpe  Drosophila persimilis
Pathway
dpe00230  Purine metabolism
dpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6591836
Enzymes [BR:dpe01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     6591836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA HNOB Guanylate_cyc zf-RING_13
Motif
Other DBs
NCBI-GeneID: 6591836
NCBI-ProteinID: XP_002017204
FlyBase: FBgn0159771
UniProt: B4GFB9
Position
Unknown
AA seq 667 aa AA seqDB search
MYGMLYESVQHYVQEEYGTHVWKKVCQIIDCKHNSFKTHQIYPDKLMPDIAAALSACTGE
SFDSCMNFFGKCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHLIMRFTYPKMKSPSMQ
LTSMDDKGAVILYRSSRTGMSKYLIGQMTEVAQEFYGLHIKAYVIESQNDISGGTAGPIK
MTEGPLTVIVKYRLDFDNSEYMAKRVNTEAHPSQLKMPTVKLDVFLDLFPFTFVLNHDMK
ITHAGEKIVETWIMHNPGANLKGFIGTHVMDLFHCRRPKDTTIDWDTLIQMRAVLFEFEL
IRTGHNRDAYDAALNMDFENYDEMDLNEAQTMAITKAKEFNDAHPAEAELAAGEDEIDPA
TGERRSSQGLKSILLKGQMFYIKDVDSLIFLCSPLIENLDELHAIGLYLNDLNPHGLSRE
LVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDDLLYSMIPRPIAERMRNSQ
EQVCESFEEVSVIFIEVLNVYDGGLNSIQGAMMAVNTLNKVFSVLDKEIISPFVYKVETV
GMVYMAVSGAPDVNPLHAQHACDMALRVMKKFHPKDMGDVAIRVGINSGPVVAGVVGQKV
PRYCLFGDTVNTASRMESSSDPWKIQLSKYTADKVRELGYKVESRGTVKVKGKGEMETYW
LLEGPEG
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtatggcatgctctatgagagtgtccagcactatgtgcaggaggagtacggcacacac
gtttggaagaaggtctgtcagatcatcgactgcaagcacaacagtttcaagacccaccag
atctatccggacaagctgatgccggacatagcggcggccctgtccgcctgcacgggcgag
tccttcgactcctgtatgaacttctttgggaagtgcttcgtcaggttctttagcaacttt
ggctacgacaagatgattcgctccacgggccgatatttctgcgactttctgcagtccatc
gacaacattcacctgatcatgcggttcacctatcccaagatgaagtcgccgagcatgcag
ctgaccagcatggacgacaagggggctgtcatcctctatcggagcagccgaacgggcatg
tccaagtaccttattgggcagatgacggaggtggctcaggaattttatggactgcacatc
aaggcatatgtaatcgagagccaaaacgacatcagcggcgggacggcgggtcccatcaag
atgacggagggtccgcttactgtcatcgtgaagtatcgcctggacttcgacaactctgaa
tatatggccaagcgtgtgaacacggaggcgcatccctcgcagctgaagatgcccacggtg
aaactggacgtttttctggacctgttccccttcaccttcgtcctgaaccacgacatgaag
attacacatgccggggagaagattgtggagacatggataatgcacaatcctggggctaat
ctcaagggcttcataggcactcacgtgatggacctgttccactgtcgacggcccaaggac
accaccatcgattgggacacattgatccagatgcgggcggttctcttcgagttcgagctg
atccgtacggggcataatcgggatgcctacgacgcagccctgaacatggactttgagaac
tacgacgaaatggatctaaacgaggcgcagaccatggccatcactaaggccaaggagttc
aatgacgcacatcctgccgaggcggagctggctgctggagaggacgaaatcgatccggcc
acgggtgaacgtcgctcctcccagggcctgaaatccattctgctcaagggtcagatgttc
tacatcaaggatgtggactcgctgattttcctgtgcagtccgttgatcgagaacctggat
gaactgcatgccattggtctgtacctgaacgatctcaacccgcatggcctcagcagggag
ctggtcatggctggctggcaacactgctcgaagctagagatcatgttcgagaaggaggag
cagcgatctgatgaactggaaaagtccttagagcttgctgactcttggaaacgtcagggt
gatgacctcctatactccatgatcccacgtcccattgccgaacgaatgaggaacagccag
gagcaggtttgtgagagcttcgaggaggtctccgtcatcttcatcgaggtcctgaatgtc
tacgacggcggcttgaacagcattcagggagccatgatggcagtgaatacgctgaacaag
gttttctcggttctcgataaggaaatcatttccccgttcgtctacaaagtggagacagtg
ggcatggtctacatggcggtgtccggggcaccggacgtcaatcccttgcatgcgcagcac
gcgtgcgatatggcactgcgcgtgatgaagaagtttcatcccaaggatatgggcgatgtg
gctattcgggtgggcatcaactcgggtcccgtggtggccggagtcgttggccaaaaggtt
ccccgttattgcctcttcggggatacggtcaataccgcctcccgcatggagagcagcagt
gatccttggaagattcagctctccaaatacacggcagacaaggtgcgagaacttggctat
aaggtcgagtcccgtggtactgtcaaggtcaagggtaagggcgaaatggagacctattgg
ctgctcgagggaccagagggctaa

DBGET integrated database retrieval system