KEGG   Drosophila persimilis: 6591838Help
Entry
6591838           CDS       T01063                                 

Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
dpe  Drosophila persimilis
Pathway
dpe00670  One carbon pool by folate
dpe00790  Folate biosynthesis
dpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    6591838
   00670 One carbon pool by folate
    6591838
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     6591838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 6591838
NCBI-ProteinID: XP_002017206
UniProt: B4GFC1
Position
Unknown
AA seq 190 aa AA seqDB search
MTGKKMLRFNLIVAVSENFGIGLKGDLPWRLKSELKYFSRTTKRTSDPNKRNVVIMGRKT
YFGVPASKRPLPERLNIVLSTTLQPAELPSDVVLCPSLEEAMKHLEEETLRDQIENVWIV
GGSGVYEEAMASSRCNRLYITKIQQNFECDTFFPSIPDCFREVPPDADTPVGVQEENGIK
YEYKVLEKRE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgactggcaaaaaaatgttgcgttttaatctaattgtcgcggtgtccgagaacttcggc
attggcttaaagggagatctgccatggcgcctaaaatccgagctgaagtattttagtcgc
accaccaagcgaaccagcgatcccaacaaacgcaatgtggtaataatgggcagaaagaca
tattttggagtgcccgccagcaagcgtccgctgccagagcgtttgaacattgttttgagc
accacgttgcagcccgcagagcttcccagtgatgtggtcttgtgccccagcctagaggaa
gccatgaagcatctggaagaggagaccttgcgcgaccaaatcgagaacgtctggattgtg
ggcggtagtggagtttacgaggaagccatggcctcgtcccgttgcaaccggctgtacata
accaaaatccagcagaatttcgagtgtgataccttctttcccagtattccagactgcttt
cgtgaggtgccgcccgatgcggacacacccgtaggcgtgcaggaggagaatggcattaag
tatgagtacaaggttttggaaaaacgagaataa

DBGET integrated database retrieval system