KEGG   Drosophila persimilis: 6594496Help
Entry
6594496           CDS       T01063                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 4
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dpe  Drosophila persimilis
Pathway
dpe03040  Spliceosome
dpe04141  Protein processing in endoplasmic reticulum
dpe04144  Endocytosis
dpe04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6594496
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6594496
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6594496
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    6594496
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpe01009]
    6594496
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dpe03041]
    6594496
   03009 Ribosome biogenesis [BR:dpe03009]
    6594496
   03110 Chaperones and folding catalysts [BR:dpe03110]
    6594496
   04131 Membrane trafficking [BR:dpe04131]
    6594496
   03051 Proteasome [BR:dpe03051]
    6594496
   03029 Mitochondrial biogenesis [BR:dpe03029]
    6594496
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpe04147]
    6594496
Protein phosphatases and associated proteins [BR:dpe01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     6594496
Spliceosome [BR:dpe03041]
 Complex B
  Other components
   Prp19 complex
    6594496
 Complex C
   Prp19-CDC5 complex
    6594496
Ribosome biogenesis [BR:dpe03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    6594496
Chaperones and folding catalysts [BR:dpe03110]
 Heat shock proteins
  HSP70 / DNAK
   6594496
Membrane trafficking [BR:dpe04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    6594496
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    6594496
Proteasome [BR:dpe03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    6594496
Mitochondrial biogenesis [BR:dpe03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    6594496
Exosome [BR:dpe04147]
 Exosomal proteins
  Proteins found in most exosomes
   6594496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A DUF4824 DUF3813 SHS2_FTSA
Motif
Other DBs
NCBI-GeneID: 6594496
NCBI-ProteinID: XP_002019695
FlyBase: FBgn0150140
UniProt: B4GLA5
Position
Unknown
AA seq 652 aa AA seqDB search
MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTQTIFDAKRLIGRKFEDSAVQSDMKHWPFDVVSVDGKPKIEVTYKDEKKTFFPEEIS
SMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTH
FVQEFKRKHKKDLTSNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRA
RFEELNADLFRSTMDPVEKALRDAKLDKSAIHDIVLVGGSTRIPKVQRLLQDLFNGKELN
KSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDI
DANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETISAKN
ALESYCFNMKATLDEENLKTKIADSDRTVILDKCTETIKWLDANQLADKEEYEHRQKELE
GICNPIVTKLYQSTGGAPGGMPGGMPGAPGAAGAGAPGAGAGGAGPTIEEVD
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagcacctgctgttggtattgatttgggcacaacctactcttgtgtgggtgtg
ttccagcatggcaaggtcgagatcattgccaacgaccagggtaatcgtacgacaccatcc
tatgttgccttcacggacacggagcgtttgattggtgatgccgccaagaatcaggtggcg
atgaacccaacccaaacgatcttcgatgccaagcgtctgattggtcgcaagtttgaggat
tctgctgtgcagtctgacatgaagcactggcccttcgatgtggtcagcgtagatggcaag
cccaagattgaggttacgtacaaggatgagaagaagaccttcttccccgaggagatctcc
tccatggtgttgaccaaaatgaaggagaccgccgaggcgtacctgggcaagacagtgacc
aatgccgtcatcactgtgccagcctacttcaacgactcgcagcgtcaggcgaccaaggat
gccggtaccattgccggattgaatgtgctgcgtatcatcaacgagcccacagccgctgct
atcgcctatggcctggacaagaaggctgttggtgagcgcaacgtgcttattttcgatctg
ggtggcggtaccttcgatgtgtccattctgtcgatcgatgacggcatcttcgaggtcaaa
tctacggccggtgatacccatcttggtggtgaggatttcgacaaccgtctagtgacccac
tttgtgcaggagttcaagcgcaagcacaagaaggacctgaccagcaacaagcgtgctctg
cgtcgtctgcgcaccgcctgcgagcgcgcaaagcgtaccctctcgtcgtccacccaggcc
agcattgagattgactctctgttcgagggtaccgatttctacacctcgatcactcgtgcc
cgtttcgaggagctgaacgccgatctgttccgcagcaccatggaccccgtggagaaggct
ctgcgtgacgccaagctggacaagtcggccatccacgacattgtgctggtcggtggctcc
acccgtatccccaaggtgcagcgcctgctccaggatctgttcaacggcaaggagctgaac
aagtcgatcaatcccgatgaggctgttgcctatggtgccgccgtccaggccgccatcttg
cacggcgacaagtcgcaggaggtgcaggatctcctgctgctcgatgtcaccccactgtct
ctgggtatcgagaccgccggcggtgtgatgagcgtgctgatcaagcgcaacaccaccatc
ccaaccaagcagacccagaccttcaccacctactcggacaaccagcccggtgtgctcatc
caggtgtacgagggcgagcgtgccatgaccaaggacaacaatctccttggaaagttcgag
ctgtcgggcattcccccagcaccacgtggcgtgccccagattgaggtcaccttcgatatt
gatgccaacggcatcctgaacgtcactgccctggagcgttccaccaacaaggagaacaag
atcaccatcaccaatgacaagggtcgtctctccaaggaggatatcgagcgcatggtcaac
gaggccgagaagtaccgcaacgaggacgagaagcagaaggagaccatctccgccaagaac
gctctcgagtcgtactgcttcaacatgaaggccacccttgatgaggaaaatctgaagacc
aagatcgccgactctgaccgtaccgtcatcttggacaagtgcaccgagaccatcaagtgg
ctggatgccaaccagctggccgataaggaggagtacgagcaccgtcagaaggagctcgag
ggtatctgcaacccgatcgtcaccaagctgtaccagagcactggcggtgctcctggtggc
atgccgggcggtatgcccggagctcccggtgcagctggagctggtgctcccggtgctggt
gccggcggtgctggccccaccatcgaggaggtcgactaa

DBGET integrated database retrieval system