KEGG   Drosophila persimilis: 6594712Help
Entry
6594712           CDS       T01063                                 

Definition
(RefSeq) probable arginine--tRNA ligase, mitochondrial
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
dpe  Drosophila persimilis
Pathway
dpe00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    6594712
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dpe01007]
    6594712
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dpe03016]
    6594712
   03029 Mitochondrial biogenesis [BR:dpe03029]
    6594712
Enzymes [BR:dpe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     6594712
Amino acid related enzymes [BR:dpe01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   6594712
Transfer RNA biogenesis [BR:dpe03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    6594712
 Prokaryotic type
   Other AARSs
    6594712
Mitochondrial biogenesis [BR:dpe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    6594712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 HTH_27 MarR_2 HTH_Crp_2
Motif
Other DBs
NCBI-GeneID: 6594712
NCBI-ProteinID: XP_002019567
FlyBase: FBgn0150068
UniProt: B4GMX7
Position
Unknown
AA seq 572 aa AA seqDB search
MIRIRRAISEQLPQLKNIYHALEVPLKKQQLQNAQRPTLEWTLPASIAQQEQELLDSLRS
HTFDATYIEKVRVVPSAGRSAAKVEFQLQPQSFVEQLLRKRQPEALPLSPSDEHVVVEYS
SPNIAKPFHVGHLRSTIIGNVLANLHQHLGYRTTRLNYLGDWGTQFGLLALGVQLTNVSD
KDMQRAPIETLYRSYVAANKAAEENPEIAQRARDLFTALEAGTDDAMAQQWQQYRQYTTE
ELSGVYNRLGVHFDSYEWESQYSQQQISEVLEKLRSAGLLQREVDGREIVVVDDRRIPVI
KSDGSTLYLARDIAALLERHSRLQFSRILYVVDNGQADHFNALFKTTAALDKRLSLEQLK
HVKFGRIHGMSTRQGKAIFLRDVLDEARDVMREKRIQTQTTRSNSSLDDEDVCDILGVSA
VLVNVLKQRRQRDHEFSWQHALQVNGDTGIKLQYTHCRLHSLLQNFKDIDLEDIRPDWQH
YSQEPVDALDLLYELARFDQSIWQSKEQLEACVLVNYLFGLCNATSRALKRLPVKQESCP
LKQSQRLLLFQAAKRTLQQGMQLLGLRPLNQM
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgatacggattcgtcgcgctatttccgagcagctgccgcagctgaagaacatttaccat
gccctggaagtgcccctgaagaagcagcaactgcaaaatgcccagcgaccgactctggaa
tggactctgccggcttccattgcgcaacaggagcaggagctgctggattccctgaggagt
cacaccttcgatgccacctacatagagaaagtgcgtgtagtgcccagcgctggacgcagt
gccgccaaagtggaattccagctgcagccgcagtcatttgtggaacagctactccggaaa
agacagccggaggctctgccactctccccgagcgacgagcatgttgttgtggagtacagt
tcccccaatatcgccaagcctttccatgtgggccacctgcgctctacgatcattggcaat
gtgctggccaatctccaccagcatttgggataccgcaccacgcgccttaattacctcgga
gattggggtacacaatttgggctcctagcacttggcgttcagctgaccaatgtcagcgat
aaggatatgcagagagcacccatagagacgctttacagatcttatgtggccgccaataaa
gcggctgaggagaacccagagattgcccagcgagcgagagaccttttcacagccctggag
gcaggaacagacgacgcgatggcccaacaatggcagcagtatcgacagtacaccactgaa
gagctctcgggggtctacaatcggttgggcgtccactttgacagctacgaatgggagtcg
cagtactcccagcagcaaatcagtgaagttctggagaagctgcggtctgcaggtcttctc
cagcgagaagtggatggccgcgagatagtggtggtggatgatcgacgcattccagtgatc
aaaagcgatggctccacgttgtatctggcaagggatatagctgctctcctcgagcgtcac
tcgcgtctgcagttctcccgcattctctatgtggtggacaatggccaagcggatcatttc
aatgccttgttcaagacaacggctgccttggacaagcgattgagtctggagcagctgaag
catgtgaaattcggccggattcatggtatgagcacgcgccagggcaaggcaatctttctg
cgggatgtcctggacgaagcacgcgatgtgatgcgagagaagcgtattcaaacacaaacc
accagatcgaatagctctctggacgatgaagatgtctgtgatatcctgggtgtttccgcc
gtcctcgtgaatgtcctcaagcagcgtcggcaacgcgatcatgaattcagctggcagcat
gcccttcaagtcaatggggatacgggcattaagctccagtacacacactgccggctgcat
agccttttgcagaacttcaaggatatagacctggaggacattagacccgattggcagcat
tacagccaggagccagtggatgccttggatttgctgtatgagctggcgcgttttgatcaa
tccatttggcaatccaaagagcaattggaggcgtgtgttctcgttaattatttatttggt
ttgtgcaatgccacaagtcgtgccctgaaacgtttacctgtaaagcaggagagctgtccg
ctgaagcaatcacagcgtttgctgctcttccaagccgccaagcggacccttcagcagggg
atgcagctactgggcctcaggccactcaaccaaatgtag

DBGET integrated database retrieval system