KEGG   Drosophila persimilis: 6594719Help
Entry
6594719           CDS       T01063                                 

Definition
(RefSeq) WD repeat-containing protein 55 homolog
Organism
dpe  Drosophila persimilis
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like BBS2_Mid Beta_propel Cytochrom_D1 Utp8
Motif
Other DBs
NCBI-GeneID: 6594719
NCBI-ProteinID: XP_002019404
FlyBase: FBgn0149996
UniProt: B4GMG4
Position
Unknown
AA seq 503 aa AA seqDB search
MHTHNNFKTPSDADELDDLDDDMVIGVIEEIAQEALVGEDVSDSDIDEHDLADVGAPEHN
QNADENESISSDSSFDPNAEDSSDSDDSMLEEDEAEGASSGEATSAKRRKDDNDGPCGSA
ADSAAVDLDDLDDETDETVRAIIAAIKKPRSAPPEIKLEDFITDVCFHPDRDIIALATII
GDVHLYEYGNEGNKLLRTIEVHSKACRDVEFTEDGRYLLTASKDKCVMVTDLETEKLKKL
YETAHDDAINKLHVLDENLFATGDDAGTVKLWDLRTKNPIFELKEVEDQITQMITNDQKK
LLLATSADGYLTTFNIAARKLYVQSEPYEEELNCMGIYRGSSKLVVGTSKGKLYSYNWGY
FGYHCDMYPGIKSPVSLMIPITDRIACVAGEDGNIRACHITPYRNLGVVGQHNMPIESLD
INTSGELLASSSHNNDVRFWNVKYFEDFGDIKYNDKHNAYKEKRHNLPSSKCTNASDFFS
DLTKEDEDNADNNDAAAGPSNSA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcatacgcataacaacttcaagactccctcagatgctgatgagcttgatgatttggac
gacgatatggttattggtgtcatagaagagatcgctcaggaggctcttgtgggggaggac
gtgtcggatagcgacatcgacgaacatgatctggcggatgtgggggcgccagaacacaat
caaaatgcagatgaaaacgagagcattagcagcgacagcagctttgatcccaatgcggag
gactcctccgactcggacgactccatgctagaggaggacgaggcggagggagctagtagc
ggggaggcgacaagcgccaagcggcgcaaggatgacaacgatggtccatgcggaagcgca
gccgattcggcagctgttgatctagacgatctggatgatgagacagacgaaacagtgcgt
gctatcatagctgccataaagaagcctcgcagtgccccaccggaaataaagcttgaagac
ttcatcacggatgtttgctttcaccccgacagagatatcattgcgctggctaccataata
ggcgatgtccatttgtacgagtacggcaatgaagggaacaagctgctgcgcactattgag
gttcattccaaggcctgtcgtgacgtggaattcactgaagacggccgctacttgctgact
gcctccaaggataagtgtgtgatggtcacagatctcgagacggagaagctaaagaagctg
tatgagacggcccacgacgatgccattaacaaactgcatgtcctagacgagaacctcttt
gccactggtgacgatgcggggacagtaaagctctgggatctgcgcaccaagaacccaata
tttgagctcaaggaagtggaggatcaaattacacagatgataaccaacgaccagaaaaaa
ctgctgctggctaccagcgccgacggctatctaaccacattcaacatcgctgcccgaaag
ctctatgttcagtcagagccgtatgaggaggagctcaactgcatgggcatctatcgggga
agctccaagctagtggtgggcacctccaagggcaaactgtattcctacaattggggctat
ttcggctaccactgcgacatgtaccccggcatcaagagtcccgtaagcctcatgataccc
attaccgatcgcatcgcttgcgtggccggagaggatggcaatataagagcctgtcatatc
acaccttaccgaaaccttggcgttgtcggccagcataatatgccaattgagtcgctggac
atcaacaccagcggggagctgctggcctcatcttcgcacaacaacgatgtacgcttctgg
aacgtgaagtatttcgaagactttggcgacatcaagtacaatgacaagcacaatgcctat
aaggagaagcgtcacaatttaccctcttctaagtgcaccaacgcgtcggactttttctcc
gatctaaccaaagaagatgaggacaatgcggacaataacgacgcagccgctggacccagt
aattcggcctaa

DBGET integrated database retrieval system