KEGG   Drosophila persimilis: 6594990Help
Entry
6594990           CDS       T01063                                 

Definition
(RefSeq) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
dpe  Drosophila persimilis
Pathway
dpe00511  Other glycan degradation
dpe00600  Sphingolipid metabolism
dpe01100  Metabolic pathways
dpe04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    6594990
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    6594990
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    6594990
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     6594990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2
Motif
Other DBs
NCBI-GeneID: 6594990
NCBI-ProteinID: XP_002020156
FlyBase: FBgn0151259
UniProt: B4GP85
Position
Unknown
AA seq 560 aa AA seqDB search
MSASKGVLLLAVLLLIAAIGGRGETVPCKVKDAEQGKVCVCTADYCDYLENPTLTDDTEF
ALISSSKQGLRFATSHGHFGTEDTYTVQDYTVEPVPEAKNKTIFSRLLDQALDSAFTLES
RESTITRFVTLKVNRSKTYQTMTGFGGSYTGAVSYLVDNFKQPELADHLYKSFYAEEGLG
FNLMRISIGGCDFDLGAWAYAEEEDNTMLDGMDELDERDVMRVGHIKRLVEVSGIKNLRI
KGAAWSAPPWMKTNNRWTGFGRLKKQYYQTWADYHLKWVKLMEDNGLPIWAISTGNEPLN
GIFFMYFVKFMSMGWTPQTQAIWLNDHLGPTIRNSEFKDIILFGNDDQRYSFPHWFKMMN
YTRPNSVDYLDGLSLHWYWDEIFGSSLIDETTDYAPDKLLIVSESCIGDKPWQRSAPVLG
SWERAEKYTRAFLENIKHGFHAWIDWNIILDEEGGPNYVDNTVDAPVIANTTTNEEFYKQ
PMFYAMGHFSKLVPEGSIRVDAVPSNVNLDCVAFLRPDKKIAAVLFNSGRADTNITVVDS
ERGQFTVNVPAKSIHTLLYS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccagcaaaggagttttgctgctcgcagtgctgctgctgatagctgcaatcggt
ggccggggggaaacggtgccgtgcaaagtgaaggatgcggagcagggaaaggtgtgcgtg
tgcacggctgattattgcgactacttggagaatcccacgctgacggacgacacagaattt
gcactgatttccagctccaagcagggtctgcgattcgccacatcccacggacacttcggg
acagaggacacgtacactgtgcaggactatactgtggagcccgttccagaggccaaaaac
aagacaattttctcccgcttgctggatcaggctttggacagtgccttcaccttggagtcg
cgcgagagcaccatcacccgcttcgtgacactgaaagtgaatcgcagcaaaacctaccag
acaatgacgggcttcggtggtagctacaccggagccgtatcctacctagtcgacaatttc
aagcagcctgagctcgccgaccatctgtacaagtccttctacgctgaagaggggctgggc
ttcaatctgatgcgcatatcgatcggcggctgcgactttgacctcggtgcctgggcctat
gccgaggaagaggacaacacaatgctcgacggcatggacgagctggacgaacgcgatgtg
atgcgtgtgggccacataaaacgcctcgtcgaggtctcgggcataaagaatctgcgaatt
aagggtgcggcctggagtgctccgccttggatgaagacgaacaacaggtggacaggattc
ggacgtctcaagaagcagtactaccagacctgggccgactaccacctcaagtgggtgaaa
ctgatggaggataatggactgcccatctgggccatttccacaggcaacgagccactgaac
ggaatcttcttcatgtactttgtcaaattcatgagcatgggctggactccacagacgcag
gccatctggttgaacgaccatctggggccaacgatccgaaactctgagttcaaggatatc
atccttttcggcaacgatgatcagcgctactcctttccacactggttcaaaatgatgaat
tacacacgccccaattcggttgattacctggacggattatcgctgcactggtattgggat
gagattttcggtagcagtcttatcgatgagaccaccgattacgcgcccgacaagctccta
atcgtctccgagtcgtgcatcggcgataagccctggcagaggtcggcccccgtcctgggc
agctgggagcgggctgagaagtacacgcgcgccttcttggagaacataaaacatggcttc
catgcctggatcgattggaatatcattttggacgaggagggcggccccaactatgtggac
aatacagtcgatgcccccgtcattgccaacaccacaaccaatgaggagttctacaagcag
cccatgttctatgccatgggtcacttctccaagctggtgccagagggctccatacgcgtc
gatgctgtgcccagcaacgtcaatctggattgcgttgccttcttgcggccggacaaaaag
attgccgccgtgctcttcaacagcggacgcgccgatacaaacattactgtggtggacagt
gagcgcggccagtttacggtcaatgtgcccgccaagtccattcacaccttgctgtacagc
tga

DBGET integrated database retrieval system