KEGG   Drosophila persimilis: 6596217Help
Entry
6596217           CDS       T01063                                 

Definition
(RefSeq) titin homolog
Organism
dpe  Drosophila persimilis
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 Ig_2 ig V-set
Motif
Other DBs
NCBI-GeneID: 6596217
NCBI-ProteinID: XP_026845569
Position
Unknown
AA seq 1460 aa AA seqDB search
MGNQPGKLHAHAQSGRPKKNVHWKSAERPSPPGRPILTPLSLSEQQPDVVNLRWDRPLLD
GGSPITGYTVEHRRMGSPHWVRATPTPVSRCDVCISGLEPGWRYQFRCFAENIVGRSDAS
ELSDPLTVTLQRNAITVPRFIDELLDTDAVEDERIEFRVRILGEPPPEINWFKDGYEIFS
SRRTKIVNDNDASVLIIHQVALTDEGEIKCTATNRAGHVVTKARLMVQAPPKIRLPRTYE
DGLIVEADEVLRLKVGIAGQPPPAISWLHEGEVIAPGGRFEVTNTEKNSLLKIDNVHRED
RGEYMVRAWNKLGEDNTSFLVTVTARPNAPGAPRLNMSFGKSATLSWTAPLDDGGCKIGN
YIVEYFRIGWNVWLKAATTRALTTTLHDLIEGSEYKFRVKAENPYGLSEPSEESELLFIP
DPKRGITKPKSATKIAGEEKDKPKSDAVQVPPRRKTLSPPRPHADAATGMSPKQSPNAKR
KPKPQLIDNEQLHHEMSYGTSDQALRMDVRKSPSQSSADSSAKPAAGSNNKLNLTLITTT
ALVEKTEPPARPQKSPVGSPLKLFNTKPTAVAKERSPLQPQPQPLPTPPAEKPGKTVLHR
KRSLSPPTNRQHSETKPTSPPEPIKSTPALQRSAEPVQLGVNQNVRRFSGQALSPARNVP
TLALAVAASASAVIGERLPTIEISAPPPATATATATAPLLVPVPEESPKPKHKPKPDSSP
VPRRTSRFADKHDEVHTSNEFMLVVFDKNSKVKDKDKQDSFELDLEDAIQPPPISISAPD
LAFLEFNNLHTTFPLRRSVSSTELLYERAMARFYEAVELEQAAKSRKASQDRIASSTQAP
VPPANLRKRLGSISEAERVSFERRSELRRQSADMVSMGRKWDSRENVNDLSSLSRTHTTG
QISGEEQQRIREHEELDEEERTESTAEDSEDMNMEMDEDYPAQGKQQSSYDLGSDYTEST
ASSEQDSIEKFKMELLARTRSPSPRDLETYHPRNMGAGTFTPYRAPTPEQAAVVLNRPMP
LPSPDFVPKPILKRSSNEHVEQPVSPPNSPSLPGNGNGSTATSAVGVAAIPQPSVPNAAP
NPSTSSLKMDLAKGIKSFFSRDKRSATEKNTEANEEISNPLEKTNAAAIAADLEVKRRAK
EEEELRRLEAERLMQEEAHAAVDHYSDLVREVGSSHKYHTPLYLDREELKRAAAKAAAET
DEDEGSMSNTEEHRRRLASKTNDDMLLAPPVVSRERRLSISEREQLVHVRDASSNLAYHK
SRDKDELVREESEQQTQRQKEEEEPEYPTILVVPPLKTRNKTEAESESVMSETVEARPDA
RGRTRLVKVKRVIKRRVPSSTRSRDTSLNRPPPPATGSLALAVERTSQTALVLSSAERDL
LERASALAVLQSEEHTHEKVRSALSYCTDLVLFLVACYVYLFKDARLVLPILGLIIYRQL
GEAVRGYIPTWLRRKGNDEA
NT seq 4383 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcagccgggaaagctgcatgcccatgcacagagcggtcgacccaagaagaat
gtccactggaagtctgcagaacgaccctctccgcctggtcggcctatactgacgccgctg
tcgctctcggagcagcagcccgatgtggtcaacctgcgctgggatcgtccgctactcgac
ggaggctctccaatcaccggctacacggtggagcaccgtcgcatgggctcgccgcattgg
gtgcgtgccacacccacgcctgtctcccggtgcgatgtctgcatcagtggactggagcca
ggctggcgataccaatttcgctgctttgccgagaacatcgtgggacgatccgacgctagc
gagctctctgatcccctaacggttacactccagcgcaacgcgataactgttccccgcttt
atcgacgagctgttggacactgatgcggtggaggacgagcggatcgagttccgggtgcgc
atcctgggcgaaccgccgccggagatcaactggttcaaggatggctatgagatcttcagc
agtcgacgcaccaagatcgtcaacgacaacgacgccagtgttctgatcatccaccaagtg
gcactgacggacgaaggcgaaatcaagtgcacagcaacgaaccgagctggccacgtggtg
accaaagccaggcttatggtgcaggcgccacccaagattcgtttgccacgcacctacgag
gacggactcatcgtggaagccgacgaggtactgcgtctgaaggtcggcattgccggacag
ccgccgccggccattagctggctccatgagggcgaagtgattgcccctggtggacgattc
gaggtcaccaatacggagaaaaattcgcttctcaagatagacaacgtgcatcgggaggac
cgtggcgaatacatggtgcgtgcatggaacaagctgggggaagacaacacatcgtttctg
gtcacggtaacggcacggccgaatgccccgggtgctccccgtctgaacatgtcgttcggc
aagtccgcaacgctctcctggacggcacctctggacgatggcggctgcaagatcggcaac
tacattgtggagtactttcgaattggctggaacgtctggctaaaggccgccaccacgcgg
gccctgacgaccactctacacgatctgatagagggctcggagtacaagttccgcgtcaag
gctgagaacccctatggcctgagtgagccatccgaggagtcggagctgctcttcataccc
gatcccaagcgtggcatcaccaagcccaagtctgccaccaaaattgccggcgaggagaag
gataagcccaagtcggacgccgtccaagtaccgccacgccgcaagacgctctctccacca
cgtccccatgcagatgctgcgacgggcatgtcgcccaagcagtcaccaaacgccaaacgc
aagccaaagcctcagctcatcgacaatgagcagctgcaccatgaaatgtcctacggcacc
tcggaccaggctctaagaatggacgtccgcaagagcccctcccagagcagtgccgactcg
tcggccaagccggcggctggatccaataacaagctcaacctcacgctgatcaccaccacc
gctctggtcgagaagacagagcccccggctaggccccagaagtcgccagttggctcacct
ctcaagttgttcaataccaagcccacggctgtggccaaagagaggtccccactgcagccc
caaccacagcccctgcccactccgcctgcggaaaagccgggtaaaacggtcctccaccga
aaacgaagtctgagtccgccaacgaatcgacaacactccgaaacgaaaccaacatcacca
ccggagcccatcaagtcaactccagccctgcagcgtagtgcggagcctgtccagctgggg
gttaaccagaatgtgagacgattctcgggccaggccctgagtccggcgaggaacgtaccc
accctggcattggcagtggctgccagtgctagtgcggtgattggcgaaaggctgcccacc
attgagatcagtgcaccaccaccagccacagcaacagcaacagccacagctccgcttcta
gttccagtcccggaagagtcccccaaaccgaaacacaagcccaaaccagactcttctcca
gttccgagacgtacctccaggtttgcggacaagcacgacgaggtgcacaccagcaacgag
ttcatgctcgtcgtcttcgacaagaacagcaaggtcaaggataaggacaagcaagattcc
ttcgagctagacctggaggatgccatacagccaccgcccatatccatctccgcaccagat
ctggcatttctggagttcaacaacctgcataccaccttcccgctgcgccggtccgtgagc
tccaccgagctgctctacgagcgagcaatggcgagattctatgaggcggtagagctggag
caagccgccaagtcgagaaaggcctcccaggacagaatagcaagcagtacgcaggcgcct
gttccgccggctaatctccgcaaacgcctgggctccatttcagaggcagagcgcgtttcg
ttcgagcggaggagcgaactgcgtcggcaatcagcggacatggttagcatgggtcgaaag
tgggactcaagggagaatgtcaacgatctgagcagcctctcacgcacgcacactacggga
cagatttcgggcgaggaacagcagcgcatccgggaacacgaagagcttgacgaagaagag
cggaccgagagcacagcagaagacagtgaagacatgaatatggagatggatgaggactat
ccagcacagggtaaacagcagtccagctacgatctgggatccgactacaccgagagcact
gcctcctcggagcaggactccattgagaagttcaagatggaactgctggctcgcactcgc
tcgcccagcccccgcgatctggagacgtaccatcctcggaacatgggcgctggcaccttt
acaccctatcgcgcccccacaccggagcaggcagctgttgtgctcaaccgccctatgcct
ctgcccagtccagactttgtccccaagccgatccttaaacgctcgtccaacgagcatgtg
gagcagccggtgagcccacccaacagtccatccttgcctggaaatggcaatggatccaca
gccacctccgcagtgggagttgcagccatcccacagccatccgtaccaaatgctgcgccc
aatcccagtacgagcagcttaaagatggacctggccaaaggcataaagtcgttctttagt
cgcgacaagcgatccgccaccgagaagaacactgaagccaacgaggagatatcgaatcct
ctggagaaaaccaatgccgctgccattgcggctgatttggaggtcaaacgcagggccaag
gaggaagaggaactacgtcgcctagaggccgagcgcctcatgcaggaggaggcccatgcc
gccgtcgatcactacagcgacctagtccgggaggtgggcagctcccacaaataccacacg
ccactctacttggaccgcgaggagctgaagcgggccgccgccaaggcagcagccgaaact
gacgaggatgagggatccatgtcaaacacggaggaacacaggaggcggctggctagcaag
accaacgacgacatgctgttggcacccccagtagtcagtcgggagcggcgtctgtccatc
tcggagagggagcagctggtacatgtccgtgatgcgtccagtaatctggcgtatcacaaa
tcacgcgacaaagatgagttagtgcgggaggagagcgagcagcagactcaaaggcagaag
gaggaggaggagccggagtacccgactatcctagtggtgccccctcttaaaacaaggaac
aagacggaggcggagagtgagagcgtcatgagcgagacggtcgaggctcgtcccgatgcc
cggggacgaacgcgtctcgtaaaggtaaagcgggtgattaagcggcgggttccgtccagc
actcggtctcgcgacacctcgctcaatagacccccaccaccagctacgggaagcctggct
ctggcagtagagaggacctcacagacggccttggttctgtcaagcgccgagcgggatctt
ctggagagagcgtccgcactggcggtgctccaatcggaggagcatacgcacgagaaggtc
cgctcggctctcagctactgtacggatctggttctcttcctggttgcctgttatgtgtac
ttgttcaaggacgcgagactggtcctgccaattctggggctgatcatttaccgccaactg
ggcgaagccgtaaggggctatatacccacctggttgcgtcgcaagggcaacgacgaggcc
tga

DBGET integrated database retrieval system