KEGG   Drosophila persimilis: 6596654Help
Entry
6596654           CDS       T01063                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
dpe  Drosophila persimilis
Pathway
dpe00020  Citrate cycle (TCA cycle)
dpe00640  Propanoate metabolism
dpe01100  Metabolic pathways
dpe01200  Carbon metabolism
Module
dpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6596654
   00640 Propanoate metabolism
    6596654
Enzymes [BR:dpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     6596654
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     6596654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 6596654
NCBI-ProteinID: XP_026845925
Position
Unknown
AA seq 342 aa AA seqDB search
MTMSNWRASGWLAPARLLRVVRGKSDYSKTAKNLKINKETKLLVQGFTGKQATFHSQEAL
KYGTNVVGGVSPKKGGTKHLDKPVFKSVAEATKELKPDATVIFIPPSNAADGIRSAIESE
IGLIVAITEGIPQVDMVRIMQMLNCQEKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGCV
GIVSRSGTLTYEAVQQTTKTGLGQTLCIGCGGDPFNGTNFIDGLKIFLSDPETKGIILIG
EIGGSAEEDAAEFLKQHNSGCKAKPVVSFIAGQTAPPGRRMGHAGAIIAGGKGTAPAKVK
ALEKAGVIVSQNPCHMGSTLYKEMLRLKLVPKKEEAGSSNKK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgtccaattggcgagcaagcggctggttggcgcccgcgcggctgcttcgtgtg
gtgcgcggcaagtccgactacagcaagacggccaagaatctgaagatcaacaaggagacc
aagctgctggtgcagggattcaccggcaagcaggccaccttccactcgcaggaggccttg
aagtacggcaccaatgtggtcggtggcgtgtcgcctaagaagggcggcaccaagcacctg
gacaagccggtcttcaagagcgtcgcggaggcgacgaaagagttgaagccggacgccacc
gtgatcttcattccgccgagcaatgccgccgatggcatacgttcggccatcgagagcgag
atcggtctgatcgtggccatcacggagggcataccgcaggtggacatggttcgcatcatg
cagatgctgaactgccaggagaagtcccgcctcctgggccccaactgcccgggcatcatc
tcccccgatcagtgcaagattggcatcatgcccggcgacatccacaagcgcggctgcgtc
ggcatcgtctcccgttcgggcaccctcacctacgaggccgtccagcagaccacaaagacc
ggcctcggccagacgctgtgcatcggctgtggcggcgaccccttcaacggcaccaatttc
atcgatggactcaagatcttcctgtctgaccccgagaccaagggcatcatcctcattggc
gagatcggcggcagtgccgaggaggacgccgccgagttcctcaagcagcacaactccggc
tgcaaggccaagcccgttgtcagcttcattgccggacagaccgccccgcccggccgtcgc
atgggccatgcgggtgccatcattgccggcggcaagggcacggccccggccaaggttaaa
gcactggagaaggcaggcgtcatcgtgtcccaaaatccctgccacatgggctccaccctc
tacaaggagatgctgcgcctcaagctcgtccccaagaaagaggaggccggctccagcaac
aagaagtag

DBGET integrated database retrieval system