KEGG   Drosophila persimilis: 6596889Help
Entry
6596889           CDS       T01063                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
dpe  Drosophila persimilis
Pathway
dpe00030  Pentose phosphate pathway
dpe00480  Glutathione metabolism
dpe01100  Metabolic pathways
dpe01200  Carbon metabolism
Module
dpe_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
dpe_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6596889
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    6596889
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     6596889
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     6596889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 NAD_binding_11 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 6596889
NCBI-ProteinID: XP_002022104
FlyBase: FBgn0151767
UniProt: B4GU25
Position
Unknown
AA seq 481 aa AA seqDB search
MSGKADIALIGLAVMGQNLILNMDEKGFVVCAYNRTVAKVKEFLANEAKGTNVIGAESLK
DMVEKLKTPRKIMLLVKAGSAVDDFIEQLVPLLSRGDVIIDGGNSEYQDTSRRCAELEKL
GLLFVGSGVSGGEEGARHGPSLMPGGHEAAWPLIKPIFQAICAKADGEPCCEWVGDGGAG
HFVKMVHNGIEYGDMQLICEAYHIMQSLGLSATQMADEFGKWNSAELDSFLIEITRDILK
YKDTKGHLLERIRDTAGQKGTGKWTAIAALQYGVPVTLIGEAVFSRCLSALKQERVHASG
VLKGSSVKPSVANVTKFLDDIKHALYCSKIVSYAQGFMLMREAAKENNWRLNYGGIALMW
RGGCIIRSVFLGNIKDAYTSQPQLSNLLLDDFFKKAIERGQDSWREVVANSFRWGIPVPA
LSTALSFYDGYRTAKLPANLLQAQRDYFGAHTYELLGDEGKFHHTNWTGTGGNVSASTYQ
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaaaagctgatattgcacttattggactggccgtgatgggccagaatctcata
ttgaatatggacgagaaggggtttgttgtgtgcgcctacaaccgcacggtggccaaggtc
aaagagtttctcgctaacgaggccaaaggcacaaatgtgattggcgctgagtcactgaag
gacatggtcgagaagctaaaaacgccgcgaaaaattatgctgttggtcaaggccggcagc
gccgtcgacgacttcatcgagcaactagtgccgctgctttcccgcggcgatgtgattatt
gatggcggcaactctgagtaccaggacacatcgcgtcgctgcgccgagttggagaagctg
ggactgctttttgtgggctcaggcgtcagcggaggcgaggagggtgcccgtcacggaccc
tccctgatgcccggcggacacgaagccgcctggcccctgattaagcctatctttcaggcc
atctgcgccaaggctgatggcgagccctgttgtgagtgggtcggcgatgggggtgcgggc
cactttgtcaagatggtgcacaatggcatcgagtatggagacatgcagttaatctgcgag
gcctaccacattatgcagagcctgggtctgtccgccacccagatggctgatgagttcggc
aagtggaactcggccgagctagactctttcctcatcgagatcacgcgcgacattctgaag
tacaaagacaccaagggacacctgctggaacggattcgggatacggccggccagaagggt
acgggcaaatggactgccattgccgccctacaatacggcgttcccgtgacgctcattggc
gaggctgtcttctcccgctgcctatccgccctcaagcaggagcgcgtccatgctagcggt
gtgctcaagggttcctcagtgaagccgagcgttgcaaatgtgacaaagttcctcgacgac
atcaagcacgctctgtactgctccaaaattgttagttacgcgcagggatttatgctgatg
cgggaggcggccaaggaaaacaactggaggctgaactacggtggtattgcgctgatgtgg
cgcggcggctgcatcatacgcagcgtctttctgggaaacatcaaggacgcgtacacatcg
cagccgcagctgtccaacctcctgctggacgacttcttcaagaaggccattgagcgaggc
caggactcgtggcgcgaggtggtggccaattccttccgctggggcattccagtgccagcg
ctctccaccgccctaagcttctacgacggctatcgcaccgccaagcttcccgcaaatctt
ctccaggcccagcgagactactttggggcccacacctacgagctgcttggcgacgagggc
aagttccatcacaccaactggacgggcaccggcggcaatgtatcggccagtacctatcag
gcatag

DBGET integrated database retrieval system