KEGG   Drosophila persimilis: 6597402Help
Entry
6597402           CDS       T01063                                 

Definition
(RefSeq) bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66
  KO
K16914  bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 [EC:1.14.11.- 1.14.11.27]
Organism
dpe  Drosophila persimilis
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dpe03009]
    6597402
   03036 Chromosome and associated proteins [BR:dpe03036]
    6597402
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone H3]-dimethyl-L-lysine36 demethylase
     6597402
    1.14.11.-  
     6597402
Ribosome biogenesis [BR:dpe03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    6597402
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    6597402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_4 Cupin_8 Cupin_1 Cupin_2
Motif
Other DBs
NCBI-GeneID: 6597402
NCBI-ProteinID: XP_002022494
UniProt: B4GUZ2
Position
Unknown
AA seq 687 aa AA seqDB search
MSDKNKKVSAFAAYRGSATSKNDVQKGTKNSDKNGAAKNNNNRNLASKNGGKQKGPPKKN
GSYSDGDNGSSSSSGEDEEDDSTDSSDEYESSESGEEYTLNSHSSQSSPETPANTRESLK
RRNDEAEGSNPIGAKRTSSTPVGQSTSAARSTQQPKAPSCPLQRRSCPLPSKKNTVPVKV
EVASPDRALLSPQSIKKEPGASMLCRIKIGLVKSVQPGGDAGAEAGAGQAVNRLEPCHKV
HKENSIEVGKRTLAQLIAPMTMATFLRDHWEKSPFRVKTTTSGGFSNLISFKMIDQMLIQ
NHVEYTTNIDVTSYEDGVRKTLNPDGRALPPSVWAHYQRGCSIRILNPSSYLVQLRQLCV
MLQEFFHCLVGANVYLTPPESQGFAPHYDDIEAFVLQVEGKKRWRIYAPTKELPRESSGN
LSQTELGDPIMDIVLKPGDLLYFPRGWIHQAITEKDSHSLHITLSAYQQQSYANLMEKLM
PLVVKESVEQTLKLRKGLPLDIFQNLGVANAEWKGAHRQKLIQHIQNLAQRLVPTEGQID
RALDQLAIKFQHEALPPTIAPQELKRTVFGAQATADRNGHCSLDYELAEGTAVRLLRANI
VRLTVDEGVLRCYYYTDNGLEYCKYEPNFFELEPFHGTVIETLIHAYPEYTKIKDLPPMG
NDEDRLEFVEALWERGILMVEKPFKKL
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaagaataaaaaggtttcggcctttgccgcctatcgcggctccgcaacctca
aagaatgatgtacaaaaaggaacaaagaattccgacaaaaatggtgccgcaaaaaataac
aacaacaggaacttggcctccaaaaatggcggaaagcagaagggtccgccaaagaagaac
ggtagctacagcgacggcgacaacggcagcagcagcagcagcggcgaagacgaggaggac
gacagcaccgacagcagtgatgaatatgaatcgtccgagagtggcgaggaatacacgctg
aacagccactcgtctcaatcctcgccagaaactccggctaatactcgtgagtcactgaag
cgtcgcaacgatgaggcggagggcagcaaccccatcggcgccaagcgtacttcatccact
ccagtcggccagtcgacatcggctgccaggtccacacagcagccaaaggcgccctcctgc
cccctccaacgtaggtcatgtccgctgcccagcaagaagaatacggttccagtcaaggtg
gaggtggcgtcgccagaccgcgcgttgctgtccccacagtcgatcaagaaggaacccggg
gccagcatgttatgcagaattaaaatcggtttagttaaatctgttcaacccggaggtgat
gcaggagcagaggctggcgctggtcaggccgtaaaccgcctggagccatgccataaagtg
cacaaggaaaacagcattgaagtgggaaagcggacactggctcagctcattgctccgatg
acgatggccactttcttgcgtgaccactgggagaagagtccatttagagtgaaaacaacg
acctcaggtggattctccaatctaatatcgttcaagatgatcgaccaaatgctgatccag
aaccacgtggagtataccaccaacatcgatgtaaccagctatgaggacggcgtgcggaag
accttgaaccctgacggtcgtgccttgccccctagcgtttgggcccactatcaacgcggc
tgcagcatccgtatcctgaatccctccagctaccttgtccagctgaggcagttgtgcgtc
atgctgcaggagtttttccattgcctggtgggggccaatgtctacctaacgccccccgag
agccagggattcgcaccgcattacgatgatattgaagcctttgttctccaggtggagggc
aagaagcgctggcgcatctacgcccccaccaaagaactgccccgtgaatcgtcgggcaac
ctcagccagaccgaattgggcgatcccataatggatatagtactgaagcccggcgatctc
ttatacttcccacgcggctggatccaccaggccatcacagagaaggactcgcattcgctg
cacattaccctcagtgcctaccagcagcaatcgtacgccaatctgatggagaagctcatg
cccctggttgttaaggagagtgtcgagcagaccttgaagctgcgcaaggggcttccgctg
gacatctttcagaaccttggcgtggccaacgccgaatggaagggcgcgcatcgccaaaag
ttgatacagcatatccagaatctagcacagcgtctggtgcccaccgagggtcagatcgat
cgggccttggaccaattggccataaaattccagcacgaggccctgccacccaccattgcg
ccccaggagttgaaacgcactgtattcggtgcacaggctaccgccgataggaatggccat
tgctcacttgattacgagctcgcagaggggacggcagtgcgtctgctgcgtgccaatatc
gtacgcctgacggtcgacgagggtgtcctgcgctgctactactacacggacaatggtttg
gagtattgtaaatatgagccaaacttctttgagctggaaccgttccatggtactgttatt
gagacgctaattcatgcctatcccgagtatacaaagatcaaagatctacccccgatggga
aacgatgaagaccgcttggagtttgtcgaagccctctgggagcgcggaatccttatggtt
gagaagcccttcaaaaaactataa

DBGET integrated database retrieval system