KEGG   Drosophila persimilis: 6599768Help
Entry
6599768           CDS       T01063                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dpe  Drosophila persimilis
Pathway
dpe00010  Glycolysis / Gluconeogenesis
dpe00562  Inositol phosphate metabolism
dpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6599768
   00562 Inositol phosphate metabolism
    6599768
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     6599768
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     6599768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 6599768
NCBI-ProteinID: XP_002024888
FlyBase: FBgn0155586
UniProt: B4H209
Position
Unknown
AA seq 472 aa AA seqDB search
MRFLLLLLVPLVAPLLVDGQEDYCFGKDSDRPQTAQFASKTAYQIVKSSNIDKQYLVPGC
EAKKMWVFHRHGTRLPKSGTIKKASRLIELRDQIVKNYREAKTKPDTNALCTEDLIAIQL
WKGNSSITPDMDEFLTSQGYDDLRGTAKLYQRYYPTVLPKDYNDTYYQFRHTDTQRTTES
FKAFAEGLFGTGNAAHPVDIPKDDLLLRPYDYCQSYKELNYKGEGSEYHKYTQSALWNST
LADISTRLGYLYTLDQADILLMYDTCRYEQAWQVDRTSVWCGAFLPEQVTVFEYAEDLKY
YYGSGYGFEEDTARLNCRLVQDMLTHLSNPVSPHVIAHFGHTTGLQTLITALGVRKDDIK
LRADNYNSLTNRRWKTSILGPFAANFVAVKYDCPAALDKEKAVFFLNQDAVQLDWCSVGL
CNWSEVLQRYKTLADANCDEYFCRSGASSLAGGALSSLLASFLLAAVVYLMH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcctgctgctgctgctagtgccactggtggcaccactcctggtggatggacag
gaggattactgctttggcaaggattccgatcgaccgcagacggcgcaatttgcctcgaaa
actgcctaccagatcgttaagagtagcaacatcgacaaacagtaccttgtccccggctgc
gaggccaagaagatgtgggtcttccacaggcacggcaccaggctgcccaaatcgggtacc
atcaagaaggcctcaaggctgatagagctgcgcgatcaaattgtcaagaactatcgggag
gcaaagaccaagcccgataccaatgccctgtgcacagaggatctgattgccattcagttg
tggaagggcaatagcagcattacccccgacatggatgagtttttgaccagccagggctac
gatgatctccgaggcactgccaagctctatcagcgctactatcccactgttctgcccaag
gactacaatgatacgtattaccagttccgtcacacggacacccagcggaccacagagagc
ttcaaagcctttgccgagggtctctttggcaccgggaatgccgctcatcccgtggacata
cccaaagacgatctcctgctgcgtccctacgactactgtcagtcgtacaaggagctcaac
tacaagggcgaaggttccgaataccacaagtacacacagtccgccttgtggaacagcacc
ctggcagatatatccacgcgattgggctatctgtacactctcgatcaggcggatatcttg
ctgatgtatgacacgtgccgctatgagcaggcatggcaggtggatcgcaccagtgtctgg
tgcggcgccttcctgcccgaacaggtgactgtctttgagtatgccgaggatctcaagtac
tactacggatcgggctatggcttcgaggaggatacggcacgtcttaactgccgtctcgtg
caggacatgctcacccacctaagcaatcccgtgtcgccgcatgtgatcgcccatttcggc
cacaccactggcctgcagaccctgatcacggcgctgggcgttcgcaaggatgacatcaag
ttgcgcgccgacaattacaacagcctgacgaaccgccgctggaagacgagcattctaggt
ccgttcgctgccaactttgtggcagtgaagtacgactgtcccgccgccctggacaaggag
aaggccgtcttcttcctcaaccaagatgccgtgcagctggattggtgcagcgttggtctc
tgcaactggtcggaggtgttgcagcgctacaagacccttgctgatgccaactgcgatgag
tacttctgccgctctggcgcctcctctctggctggcggcgctctgtcttccctcctggct
tccttcctccttgctgctgtagtctacttaatgcactaa

DBGET integrated database retrieval system