KEGG   Drosophila persimilis: 6601068Help
Entry
6601068           CDS       T01063                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase isoform X1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dpe  Drosophila persimilis
Pathway
dpe00480  Glutathione metabolism
dpe00590  Arachidonic acid metabolism
dpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    6601068
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    6601068
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     6601068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 6601068
NCBI-ProteinID: XP_002026092
FlyBase: FBgn0153745
UniProt: B4H5G3
Position
Unknown
AA seq 238 aa AA seqDB search
MSLRQFQTISQQVFRCLSTRAATSRRILGPVIELSQSQRQNLKFCTVLLPVSCAAAVSAP
QYSTAAAIDMSANGDYKNAASIYEFTVKDTHGSEVSLDKYKGRVLLVVNIASKCGLTKNN
YQKLTELKEKFGERGLTILNFPCNQFNSQMPEADGEAMVCHLRDAKADIGEIFARVDVNG
DNAAPVYKYLKAKQSGTLGSGLKWNFTKFLVNKEGIPINRYAPTTDPMDIAKDIEKLL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcaggcagtttcagaccatttcgcagcaggttttcaggtgcttatcgactcgg
gccgcaacaagtcgaagaatccttgggccggtcatcgaactgagtcagagtcaaaggcag
aatctaaagttctgcacggtcctcctgccagtcagctgtgcggcagccgtcagtgccccc
cagtactccacagcagctgccatcgacatgtctgccaacggagattacaagaacgccgct
tctatctatgagttcaccgtaaaggacacccatggaagtgaagtgtcgctggacaaatac
aagggccgagtacttctggtagttaatatcgcttccaagtgcggactgactaagaacaac
tatcagaagttgaccgaattgaaggagaagttcggcgagcgtggactcaccattttgaac
ttcccctgcaatcagttcaactcccaaatgccggaggccgacggcgaggcaatggtctgt
catctgcgcgatgccaaggctgacattggagaaatctttgccagggtggatgtcaatggc
gataacgctgctccggtctacaagtacttgaaggccaaacagtctggcactttgggcagt
ggtctcaagtggaactttacaaagttcctggtcaacaaagagggaatcccaatcaatcgt
tatgccccaaccaccgatcctatggacattgccaaggatattgagaaactattgtag

DBGET integrated database retrieval system