KEGG   Drosophila persimilis: 6602875Help
Entry
6602875           CDS       T01063                                 

Definition
(RefSeq) exportin-5
  KO
K14289  exportin-5
Organism
dpe  Drosophila persimilis
Pathway
dpe03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    6602875
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dpe03016]
    6602875
   03036 Chromosome and associated proteins [BR:dpe03036]
    6602875
Transfer RNA biogenesis [BR:dpe03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    6602875
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     6602875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 6602875
NCBI-ProteinID: XP_026849663
Position
Unknown
AA seq 1232 aa AA seqDB search
MAHQAGTEALAAELAKAVEVIMHPMTQQNSRLEAYMACERFKEESPLCAQVGLFLAGSPQ
FNQQVRHFGLQLIEYTIKYKWNCITHEEKVYIKDNAIKMLNIGVGPAEDRSLMPLKNALS
KIIVEMIKREWPQQWSDLLPELSQACTNGEAQTELVLMVFLRLVEDVALLQTIESNQRRK
DMYQALNNNMNDIFEFFLRLVEQHVTAFRETTRLGNFHKANAHSRVVEMVLLTLSGFVEW
VSIQHVMSNNGKLMHFLCILLNDKAFQSNAAECLAQITNRKGQAKERKPLMQLYNEEPLR
YIFSSSQIPADTSSSLAIEQQHLFLKKLLAVLNGMNQQLVALWGKDESTQRPVHLEIMLE
CLLLLVQHPSLSVAHGAAQIWQLLLKHELCSKDFAMINYIPKLIHTIAPRIVKLPYPPAS
SPTSLTTESYIRMDYDSEEEFTLYFFRCRTDFLEIFRLATLVQPLITYGFCEQWLQSRLR
NAVAESAGMSCSVLDPVYLEWDALVSVLDGVLSRILLVSERPSVPAGLRLLEDCLKLETT
NPLIYSILLSCISALFVFLSMSSCQITSNNCVAMNGVTLLPRVLDKIFRALVLKPPNELE
KVQVKSAKNLRRHAASLLVKLAHKYPLLLLPVFDQINNHVQLLLKEPNRHQLCRVMRTTL
QEALILISNHFCDYERQTAFIEHIVLEKRSEWISFEEAFKSALHFMRFVGLDKPPVFAID
SDPSIPNRTRIIDALHVVLGVVKRCTWPDDPDRAQRGGFVIACTEVGNPICRNPATKHVV
PVLSHVLTLMRVLNEMFTPEALAALSEGYRNIHGMLEHEKKLLMGICALPADPLDTTIKR
EPTAFEKMQTFMMLVTEGCYHLMGSAGPSLGRDLYQLNGMANAIITNVFSCMDIIPDYRM
RPIIRVFFKPFVYSCPPIFYDDVLVPLFAHLTPLMCERLTRRWLYISSLYESGQLTGEVN
DTQEVLEDQLNRTLTREYLDVLKIALVGGQIGSDHVASGGGGGTANVVAMENEEHSMDSA
PQSRASQSALLSDIISDLGGKLLRNGLIGNYILMTLLKAIAWNDGMVNMKAVNIAAPVMR
FLAAEHLMDENKAVSAFTAVLQGMQVHGQHEANQSGLITLGVQFYELLRPKFPILSEVLQ
HIPSVNAADIQKFDEKTAVAPVKGNKVDRAKKDIFKKLTAQLVGRSVNQLFRHEVQIANL
PPMQPHKLKSTGNNIMDSNQNANLTKLFGSDK
NT seq 3699 nt NT seq  +upstreamnt  +downstreamnt
atggcacaccaggcaggcacagaggccttggctgccgaactggccaaggctgtggaggtg
ataatgcatcccatgacgcagcagaactctcgactggaggcatacatggcctgcgagcga
ttcaaggaggagtcgccgctgtgtgcacaggtcggcctctttctggccggctcgccccag
ttcaatcagcaggtgcgccacttcggcctgcagctgatcgagtacacaatcaaatacaaa
tggaattgcatcacccacgaagagaaggtctacatcaaagacaatgccatcaagatgctg
aacatcggtgtgggccccgcggaagatcgctctctgatgcccctgaagaatgccctgtcc
aagatcattgtcgagatgataaaacgcgaatggccgcagcagtggtcggacctgctgccc
gagcttagccaggcctgcaccaatggcgaggcccagacggagctggtcctgatggtcttt
ctgcgtctggtcgaggacgtggccctgctgcagaccatcgagtcgaatcagcgccgcaag
gacatgtaccaggccctcaacaacaacatgaacgacatcttcgagttctttctgcggctc
gtcgagcagcatgtgacggcctttcgcgaaaccacgcgtctgggcaactttcacaaggcc
aacgcccacagccgtgtggtggaaatggtactcctcactctcagcgggtttgtggagtgg
gtcagcatccagcacgtgatgtccaacaatggcaaactgatgcatttcctttgcattcta
ctgaacgacaaagcattccagagcaatgcggccgaatgcctcgcccagatcaccaatcgc
aagggccaggccaaggagcggaagcccctcatgcagctgtacaacgaggagccgctgcgc
tacatcttctcatccagccagataccggccgacactagttcctcgctggccatcgagcag
cagcacttgttcctcaagaagctgctggcggtgctcaatggcatgaaccagcagctggtg
gcgctgtggggcaaggacgagtcgacacagcgtccagtgcatttggagataatgctcgag
tgcctgctgctgctagtgcagcatccatcgctgagcgtcgcccatggagccgcacagatc
tggcagctgttgctcaagcatgagctctgctcgaaggactttgccatgatcaactacatt
cccaaactgatccacactattgccccgaggattgtgaagctgccgtatccgccggccagc
tcgcccacgagcctcaccacagagtcgtacatccgcatggactacgacagcgaggaggag
ttcacgctgtacttttttcgctgccgcaccgacttcctggagatctttcgcctggccacc
ctcgtccagcccctgatcacgtacggcttctgcgagcagtggctgcagtcgcggctccgc
aatgccgtcgccgagagcgccgggatgtcgtgcagcgtactggatcctgtctacctcgaa
tgggatgccctcgtgagtgtactggacggtgtgctcagccgcatactgctcgtctcggag
cgtccgtcggtgccggccggcctgcgcctgctggaggattgcctgaagctggagaccacc
aatccgctgatctactcgatcttgttgtcctgcatatcggccctgttcgtctttctcagc
atgtcctcgtgccagataacctccaacaactgtgtggccatgaacggagtcaccctgttg
ccccgcgtcctggacaagatctttcgcgccctcgtcctgaagccgcccaacgagctggaa
aaggtgcaggtcaagtcggccaagaatctgcgccgccatgccgcctcgctgctggtcaag
ctggcccacaaatacccgctgctgctgctgcccgtcttcgatcagatcaacaatcacgtg
cagctcctgctgaaggagcccaaccggcatcagctgtgccgcgtgatgcgcaccaccctg
caggaggccctgatcctcatctccaatcacttttgcgactacgaacgccagacggcgttc
attgagcacatcgtgctggagaagcggtccgagtggatctcctttgaggaggccttcaag
tcggcgctgcactttatgcgcttcgtgggcctggacaagccccccgtctttgccattgac
agcgatccctcgattccgaaccggacgcgaatcatagacgccctgcatgtggttctgggc
gttgtcaagcggtgcacatggcccgacgatccggaccgggcacagcgcggcggctttgtg
atcgcctgcaccgaggtggggaatcccatttgccgcaatccggccaccaagcatgtggtg
ccggtgctctcccacgttctcactttgatgcgtgtcctcaacgagatgttcacccccgag
gcgttggccgccctctccgaaggataccgcaacatacacggcatgctcgagcacgaaaag
aagctgctgatgggcatctgtgccctgccagccgatcccctggacaccaccatcaagcgg
gagccgaccgccttcgagaagatgcagacattcatgatgctggtcacggaggggtgctac
catctgatgggctcggcgggaccatcgctggggcgcgatctctatcaattgaatggcatg
gcaaatgccatcatcacgaatgtctttagctgcatggacatcattccggactaccgcatg
cgccccattatccgggtgttcttcaagcccttcgtctactcctgcccgcccatcttctac
gacgacgtgctggtgcccttgttcgcgcatctgacgccgctgatgtgcgaacgcctcacc
agacgctggctatacatatcatctctgtacgagagcggtcagctcactggcgaggtcaat
gatacccaggaggtgctcgaggatcagctgaaccgcaccctgacgcgtgagtatctcgat
gtcttgaagatagcgctggtgggtggccagatcgggtccgatcatgtggcctctggcggc
ggcggcggcaccgccaatgtcgtggccatggagaacgaggagcactcgatggacagtgcc
ccccagtcgcgggcctcccagtcggccctcctctcggacataatcagcgatctgggcggg
aagctgctgcgcaacggcctcatcggcaactacatcctgatgaccctgctgaaggcgatc
gcctggaacgatggcatggtcaacatgaaggccgtcaatatagcggccccggtgatgcgc
tttctggccgccgaacatctgatggacgagaacaaggcggtgagcgccttcacggccgtc
ctccagggcatgcaggtgcatggccagcacgaggccaaccagtccggcctgatcacattg
ggtgtgcagttctacgagctgttgcgccccaaatttccgatcctcagcgaggtgctacaa
cacattcccagcgtgaatgcggccgacattcagaagttcgatgagaaaaccgccgtggcc
cccgtcaaggggaacaaggtcgatcgcgccaagaaggatatattcaagaagctgacggcc
cagctggtgggacgcagtgttaaccagctcttccgccatgaggtgcagatcgccaatctg
ccgccaatgcagccgcacaagctcaagtccacgggcaacaacatcatggacagcaatcaa
aacgccaatctgaccaagctctttggttcggataagtga

DBGET integrated database retrieval system