KEGG   Drosophila persimilis: 6603366Help
Entry
6603366           CDS       T01063                                 

Definition
(RefSeq) mitogen-activated protein kinase ERK-A isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dpe  Drosophila persimilis
Pathway
dpe04013  MAPK signaling pathway - fly
dpe04068  FoxO signaling pathway
dpe04140  Autophagy - animal
dpe04150  mTOR signaling pathway
dpe04214  Apoptosis - fly
dpe04320  Dorso-ventral axis formation
dpe04350  TGF-beta signaling pathway
dpe04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    6603366
   04350 TGF-beta signaling pathway
    6603366
   04068 FoxO signaling pathway
    6603366
   04150 mTOR signaling pathway
    6603366
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6603366
  09143 Cell growth and death
   04214 Apoptosis - fly
    6603366
 09150 Organismal Systems
  09158 Development
   04320 Dorso-ventral axis formation
    6603366
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    6603366
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpe01001]
    6603366
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dpe03036]
    6603366
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpe04147]
    6603366
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     6603366
Protein kinases [BR:dpe01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   6603366
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     6603366
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   6603366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase YukC Choline_kinase FTA2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 6603366
NCBI-ProteinID: XP_026843449
Position
Unknown
AA seq 376 aa AA seqDB search
MAEANAAGTSVEGAVGLLAPHPNAELIRGQIFEVGPRYTKLAYIGEGAYGMVVSADDTIT
NQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIEQMRDVYIVQCL
METDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICD
FGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPI
FPGKHYLDQLNHILGVLGSPSREDLECIINEKARNYLESLPFKPNVPWSRLFPNADPLAL
DLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLI
FEETLKFKERQPEQAI
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcaaatgctgctggaacaagtgtggaaggtgctgttggtttgctagccccg
caccctaatgctgaactaataaggggtcaaatttttgaagtgggtcccagatataccaaa
ttagcttacattggcgaaggagcttacggcatggtggtatctgccgatgacacgataaca
aaccaaagagttgcaattaaaaaaatttcgccgtttgaacaccaaacgtattgtcaaaga
acactcagagagataaccatcctgacccgatttaaacatgaaaacattattgatatacga
gacatcttgcgagtagatagtatagaacagatgagggatgtttatattgtacagtgttta
atggagactgatttgtataaactacttaaaactcagaggctcagtaatgaccatatctgc
tacttcctgtatcaaatattacgaggattgaagtacattcattcagcaaacgttttacat
cgggatttaaagccaagcaatctattgttgaataagacgtgtgatttaaaaatttgcgat
tttggattagcccgaattgcagatcctgagcacgaccatactggcttcctaacagaatat
gttgctactcggtggtatcgcgcacctgaaattatgctcaattccaagggatacacaaaa
tctattgatatctggtccgttgggtgcattttggctgaaatgttaagtaatcgaccaata
ttccctggaaaacattatctggaccaactaaatcatattcttggtgtcttgggatctcca
tcgcgcgaagatttagagtgcattattaatgaaaaggcacgtaactatttggagtctttg
ccttttaagccaaatgttccatggtcgagacttttcccaaatgccgatcccttggcttta
gatcttcttggaaaaatgttgacatttaatccgcacaaaagaattccagttgaagaagcc
cttgcacatccctacttagagcagtattatgaccctggagatgagcctgttgccgaagta
ccatttcgcataaatatggaaaatgacgatatatctcgagacgccttaaagtcattgatt
ttcgaagaaactttgaaatttaaagaacgacagccagaacaagcaatttaa

DBGET integrated database retrieval system