KEGG   Drosophila persimilis: Dper_GL11994Help
Entry
Dper_GL11994      CDS       T01063                                 

Definition
(RefSeq) GL11994 gene product from transcript GL11994-RA
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dpe  Drosophila persimilis
Pathway
dpe00020  Citrate cycle (TCA cycle)
dpe00310  Lysine degradation
dpe01100  Metabolic pathways
dpe01200  Carbon metabolism
Module
dpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dper_GL11994
  Amino acid metabolism
   00310 Lysine degradation
    Dper_GL11994
Enzymes [BR:dpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dper_GL11994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-GeneID: 6594612
NCBI-ProteinID: XP_002019835
FlyBase: FBgn0149602
UniProt: B4GLP5
AA seq 145 aa AA seqDB search
MVYRDYVDISVAVATPRGLMVPVIRNVESMNYADIEITLAGLADKAKRDAITVEDMDGGT
FTISNGGVFGSLMGTPIINPPQSAILGMHGIFERPIAVKGEVKIRPMMYVALTYDHRIID
GREAVLFLRKIKAAVENPAIIVAGL
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggtttaccgcgattatgtggacatctcggtggccgtggccacaccccgtggactgatg
gttcccgtcatccggaatgtggagagcatgaactatgccgacattgagattacattggcc
ggtctggccgacaaggccaagcgcgacgccatcaccgtagaggacatggacggcggcacc
tttaccatcagcaatggaggagttttcggctccctgatgggcacgcccatcatcaatcca
cctcagagtgctattctcggcatgcacggcatcttcgagcgtcccatcgccgtcaaggga
gaggtcaaaattcgtcccatgatgtatgtggcgctgacctacgatcaccggatcatcgat
ggacgcgaggccgttctgttcctgcgcaagatcaaggctgccgtggagaatcctgcaatc
atcgtcgccggcttgtag

DBGET integrated database retrieval system