KEGG   Drosophila persimilis: Dper_GL15861Help
Entry
Dper_GL15861      CDS       T01063                                 

Definition
(RefSeq) GL15861 gene product from transcript GL15861-RA
  KO
K11252  histone H2B
Organism
dpe  Drosophila persimilis
Brite
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dper_GL15861
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dper_GL15861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 6599391
NCBI-ProteinID: XP_002024443
FlyBase: FBgn0153465
UniProt: B4H0W8
AA seq 127 aa AA seqDB search
MPPKTASGNATKKAGKAQKNIHINTTDKKKRRKVRKESYAIYIYKVLKQVHPDTGVSSKA
MSIMNSFVNDIFERIASEASRLGHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgaaaactgcaagcgggaacgcaaccaagaaggctggaaaggcacagaagaac
atccacatcaacactaccgacaagaagaagaggcgcaaggtcaggaaggagagctatgcc
atctatatctacaaagttctgaagcaagtccacccggacactggtgtctcctccaaggcg
atgagcatcatgaacagctttgtaaacgatatcttcgagcgcattgcctcggaagcctct
cgtttgggtcactacaacaaaaagtccaccatcacaagtcgggaaatccaaacggctgtg
cggctacttctgccgggagagctggccaagcacgccgtcagtgagggaaccaaggccgtc
acgaagtacaccagctctaagtaa

DBGET integrated database retrieval system