KEGG   Drosophila persimilis: Dper_GL16995Help
Entry
Dper_GL16995      CDS       T01063                                 

Definition
(RefSeq) GL16995 gene product from transcript GL16995-RA
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dpe  Drosophila persimilis
Pathway
dpe00062  Fatty acid elongation
dpe00071  Fatty acid degradation
dpe00280  Valine, leucine and isoleucine degradation
dpe00310  Lysine degradation
dpe00380  Tryptophan metabolism
dpe00410  beta-Alanine metabolism
dpe00640  Propanoate metabolism
dpe00650  Butanoate metabolism
dpe01100  Metabolic pathways
dpe01200  Carbon metabolism
dpe01212  Fatty acid metabolism
Module
dpe_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
dpe_M00085  Fatty acid biosynthesis, elongation, mitochondria
dpe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dper_GL16995
   00650 Butanoate metabolism
    Dper_GL16995
  Lipid metabolism
   00062 Fatty acid elongation
    Dper_GL16995
   00071 Fatty acid degradation
    Dper_GL16995
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dper_GL16995
   00310 Lysine degradation
    Dper_GL16995
   00380 Tryptophan metabolism
    Dper_GL16995
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dper_GL16995
Enzymes [BR:dpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dper_GL16995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 6592438
NCBI-ProteinID: XP_002018011
FlyBase: FBgn0154599
UniProt: B4GH80
AA seq 296 aa AA seqDB search
MANFAKIFASRAQNVLQTAGRQPQVAARFSRSVSSGSNWEFIKTDVTGEKKNVGRDHTES
SQGTECPLQRPHEGISTALQQFSKDKSIAAIVLTGSEKAFAAGADIKEMVGNTYSQCIQG
NFLNDWVEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAG
GTQRLTRVVGKSKAMEMCLTGNMISAQEAEKLGLASKVVPADQLLAEAIKLAEKIGTHSS
LIVQLCKESVNTAYETTLQEGLKFERRTFHATFSTADRKEGMTAFAEKRPANFTNE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggccaattttgctaagatcttcgcctcccgcgcccagaacgtgctccagactgccggc
agacagccacaggtggccgccagattcagccgcagcgtttcctcgggtagtaactgggag
ttcattaagaccgatgtgacgggggagaagaaaaatgtgggccgtgatcacactgaatcg
tcccaaggcactgaatgccctctgcaacggcctcatgaaggaatctccaccgctctgcag
cagttttccaaggacaagagcatcgccgccattgtgctgactggcagtgagaaggctttc
gccgccggcgctgacatcaaggagatggtgggaaacacctactcgcagtgcattcaagga
aacttcctcaatgactgggttgaggtggcacgcacccagaagcccatcattgctgctgtg
aatggctatgccctaggtggcggctgtgagctagccatgatgtgtgacatcatctatgct
ggcgacaaggccaagtttggccagcctgagatcgctctaggcacgattcccggagctggc
ggcacccaacgcctcacccgcgtcgtgggcaagtccaaggccatggagatgtgcctcact
ggcaacatgatcagtgcccaggaggccgagaagctgggtctggccagcaaggtcgttcca
gctgatcagctgctcgccgaggccatcaaacttgctgagaaaattggcacccactcgagc
ctgattgttcagctgtgcaaggagtcggtgaacacggcctacgagaccacactccaggag
ggtctgaagttcgagcgtcgcaccttccacgccacgttctccacggccgatcgtaaggag
ggcatgaccgcctttgcagagaagcgcccagccaacttcaccaacgaataa

DBGET integrated database retrieval system