KEGG   Drosophila persimilis: Dper_GL17825Help
Entry
Dper_GL17825      CDS       T01063                                 

Definition
(RefSeq) GL17825 gene product from transcript GL17825-RA
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dpe  Drosophila persimilis
Pathway
dpe04711  Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    Dper_GL17825
Enzymes [BR:dpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dper_GL17825
Transcription factors [BR:dpe03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Dper_GL17825
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dper_GL17825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 PAS_3 HLH PAS
Motif
Other DBs
NCBI-GeneID: 6599863
NCBI-ProteinID: XP_002024985
FlyBase: FBgn0155428
UniProt: B4H2A6
AA seq 1039 aa AA seqDB search
MDDESDDKDDTKRKSRNLSEKKRRDQFNSLVCDLSTLISTSGRKMDKSTVLKSTISFLRN
HNEAADRSKVFEIQQDWKPTFLSNDEFTHLMLESLDGFMIVFSSLGAIFYASESITSQLG
YLPQDLYRMNIYDLAYEMDHEALMNVFVNPPPVIEPRQTEISASNEISFYSHIRRGGVEK
ADTNSYELVKFVGYFRNDPNTSAGSRSASPSGSQSAPVLPRIFRENTSVEVDRKLVFVGT
GRVQNPQLIREMSIIDPTSNEFTSKHSMEWKFLFLDHRAPPIIGYMPFEVLGTSGYDYYH
VDDLDNIVACHEELRQTGEGKSCYYRFLTKGQQWIWLQTDYFVSYHQFNTKPDYVVCTHN
VVSYAEVIKHTQKERQQASSKDCKAQTSTASSSKPATATTTLRDLELANENLESNLLDNS
LSKLTNETTATSPAVESSPMWSATVTVAAAAASGSCQANPLKIARPASSYSNISSTGISP
KAKRKCYFYNNRGNDSDSTSMSTESGTSRQSGASRHSVLTHASSQSQRQRSQLRDHSQSH
NNNHHQQQQQQQQHQQQQAQQQQQQQQHLQHLQQQQQQIQQQLQQNVGPPKLVPMLPIGP
AQIMAGNAFPQSPYPLASPQLVAPTFLEPQQFLAAIPMQPVIGPFPVPPVPVLSPLAVPS
QGQGQQELLPGSVVMTPTQSQLQDQLQRKHDELQKLIMQQQDELRIVSEQLLLARYTYFQ
PVVQMGLSPGNIAPGNMTPGSMTPGAAMPNAAGGSVQQRAFNFSSTNAVQPHFNQYGFAL
NSEQMQNQQDQQMMMQQQQNLHSQQQHNLHQQHQNQNQMQQQQHLLEQQQLQLQQQQQNE
MLSREDIEDIDAFLNLSPLQSLEPPAALNPSHNNNHSSFNNGNGNSSQNIIGHNNSNNNN
NNSNSNNNNNNSSSTAPQNHNEDSLLSYMQMATSPSVNFHMGISDDSETQSEDKMRMGSS
SSHLQLQQQHLLQQQQQQQQQQHQQLPESSSFYHSNPFVAHLQNQNQLPNDLEILPFQMS
QEQSQNLFDASNTAPGGSQ
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgagagcgacgacaaggatgatacgaaaagaaagtcacggaatctgagcgag
aaaaagcgacgggatcagttcaactctttggtctgcgatctgagcaccctgatatccacc
tccggtcggaagatggacaagtcgacggtcctcaagtcaaccatttcattcctgaggaat
cataatgaggccgcggaccgatccaaggtttttgagatacaacaagactggaagcccacg
tttctgagcaacgacgagttcacgcacctgatgctggagtccctcgatggtttcatgata
gtctttagcagcttgggtgctatattctatgcctcggaaagtattacctcacagctgggc
tatttgccgcaagacctgtacagaatgaacatctacgatctggcctatgaaatggaccac
gaggccctcatgaacgtcttcgtcaatccgccgcctgtgatcgagccccggcagacggaa
atcagtgccagcaacgagatatccttctacagccatataaggcgcggcggggtcgagaag
gcggataccaactcctacgaactggttaaatttgtgggttactttcgtaacgatcccaac
acctcggcgggctcccgttccgcaagtccgagcggcagccagtctgcgcccgtcctgccg
cgcatcttccgtgagaacaccagcgtggaggtggacagaaagctggtatttgtgggcacg
ggccgcgtccagaacccgcagctgatacgcgagatgagcataatcgacccaaccagcaac
gagtttacttcgaagcacagcatggagtggaagttcctgtttctcgatcaccgcgcgccc
ccaatcattggctacatgccgttcgaggtgctgggcacctccggatacgattactatcac
gtcgacgacttggacaacattgtggcgtgccacgaagagttgcgacaaacgggcgaggga
aaatcctgctattaccgcttccttaccaagggccagcaatggatatggctgcaaacggac
tactttgtaagctatcatcaattcaacacgaagccggactacgttgtgtgcacccacaat
gttgtcagctatgcggaggtcatcaagcacactcagaaggagcgccagcaggcgagcagc
aaggactgcaaggcccagacctcgacggccagcagcagcaagccggcgacggccacgaca
acgctgagagacttggagctggccaatgagaatctggagagtaacctgctggacaatagc
ctatcgaaattgaccaatgaaacgactgccacctcacccgcagtggagtcgtcacccatg
tggtcagcgacggtgacggtagcggcagcggcagcatcgggctcgtgccaagcaaatcct
ctgaaaatagccaggccagcctcgagctatagcaacattagctctacgggtatctcgcca
aaagccaagcggaaatgttacttctacaacaacagaggcaatgattcggattccacttca
atgtctacggaatcaggcaccagcagacagtcgggagccagcaggcactccgtgttgacg
catgcgagttcgcaaagtcaacgacagcggtcacagcttcgtgatcacagtcaaagtcat
aataataaccatcaccagcagcagcagcagcagcaacagcaccaacagcagcaggcgcaa
cagcagcagcagcagcaacaacatctgcaacacctccagcaacagcagcagcagatccaa
cagcagctgcaacagaacgtggggccgcccaagctggtgcccatgctgcctatcggaccc
gcacagatcatggcaggcaacgcgtttccgcagtccccctatcctctggccagcccccag
ctggtggcgcctacttttctggaaccgcagcagttcctggcagccatacccatgcagcca
gtgatagggccgttcccggtgccgccagtccctgtcctctcgccgctggctgtgccgagt
caagggcaagggcagcaggaactactgcccggaagtgtggtgatgacgccgacgcaaagt
cagctgcaggatcagctgcagcgcaaacacgacgagctgcagaagctgataatgcagcaa
caggacgagctgcggattgtgtcggagcagctgctgctagcccgctatacgtacttccag
cccgtggtgcagatgggactctcaccgggcaacatagcaccgggcaacatgacaccgggc
agcatgacaccgggagctgcgatgcccaatgcggcgggtggcagcgttcagcagcgcgca
ttcaacttctcaagcacgaatgcagtgcagccgcattttaatcagtatggattcgcgctg
aactcggagcagatgcagaaccagcaggaccaacagatgatgatgcagcagcagcagaac
cttcacagtcagcagcagcataatctccatcagcagcatcagaatcagaatcaaatgcag
cagcagcaacatcttttggagcagcagcaattgcagctgcaacagcagcagcagaacgaa
atgttgtcgcgcgaggacattgaggacattgatgcctttctcaatctgtcgccgctgcaa
tcgctcgagcctccagctgcactaaaccctagccacaacaacaaccattccagctttaac
aatggcaacggcaacagcagtcagaacatcatcggccacaacaacagcaacaacaacaac
aacaacagcaacagcaacaacaacaacaacaacagcagctcgactgccccacagaatcac
aacgaagactccttgttgtcgtatatgcagatggccacaagcccttcggtcaacttccac
atgggcatcagtgatgattccgagacgcagagtgaagacaagatgaggatgggcagcagc
agtagccacctgcagctgcagcagcaacatctcctgcagcaacagcaacagcagcaacaa
caacaacaccagcagctaccagagtcgagcagtttttaccattcgaatccattcgtcgcc
cacctacagaatcagaatcaattgccaaacgacctggaaatattgccctttcaaatgtcg
caagagcaatcacagaatctattcgatgcatcaaacacagcccctggcggaagtcaataa

DBGET integrated database retrieval system