KEGG   Drosophila persimilis: Dper_GL18778Help
Entry
Dper_GL18778      CDS       T01063                                 

Definition
(RefSeq) GL18778 gene product from transcript GL18778-RA
  KO
K08738  cytochrome c
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dper_GL18778
   04215 Apoptosis - multiple species
    Dper_GL18778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Cytochrome-c551
Motif
Other DBs
NCBI-GeneID: 6589079
NCBI-ProteinID: XP_002014754
FlyBase: FBgn0156379
UniProt: B4G8S0
AA seq 116 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTRMILAGLKKPNERGDTDCLPEVCHQLRKLVTTT
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttccagctggtgatgttgagaagggcaagaagctgttcgtgcagcgttgcgca
cagtgccacaccgtggaggctggtggcaagcacaaggttggtcccaatctgcatggtctg
atcggtcgcaagactggccaggctgccggtttcgcatacacggacgccaacaaggccaag
ggaatcacctggaatgaggataccctcttcgagtacctggagaaccccaagaagtacatc
cccggcaccaggatgatcttggccggtctgaagaagcccaatgagcgcggtgatactgat
tgcctacctgaagtctgccaccaactgaggaaacttgtgacaaccacgtaa

DBGET integrated database retrieval system