KEGG   Drosophila persimilis: Dper_GL19446Help
Entry
Dper_GL19446      CDS       T01063                                 

Definition
(RefSeq) GL19446 gene product from transcript GL19446-RA
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dpe  Drosophila persimilis
Pathway
dpe00040  Pentose and glucuronate interconversions
dpe00053  Ascorbate and aldarate metabolism
dpe00830  Retinol metabolism
dpe00860  Porphyrin and chlorophyll metabolism
dpe00980  Metabolism of xenobiotics by cytochrome P450
dpe00982  Drug metabolism - cytochrome P450
dpe00983  Drug metabolism - other enzymes
dpe01100  Metabolic pathways
Module
dpe_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dper_GL19446
   00053 Ascorbate and aldarate metabolism
    Dper_GL19446
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dper_GL19446
   00860 Porphyrin and chlorophyll metabolism
    Dper_GL19446
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dper_GL19446
   00982 Drug metabolism - cytochrome P450
    Dper_GL19446
   00983 Drug metabolism - other enzymes
    Dper_GL19446
Enzymes [BR:dpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dper_GL19446
Glycosyltransferases [BR:dpe01003]
 Others
  Hydrophobic molecule
   Dper_GL19446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glycos_transf_1
Motif
Other DBs
NCBI-GeneID: 6588742
NCBI-ProteinID: XP_002014939
FlyBase: FBgn0157045
UniProt: B4G9A5
AA seq 520 aa AA seqDB search
MCSSLLTVVLLGLTLGHTGVEVNAGPPLKILGLFPHPGVSHFHFFHPIMRGLAEAGHDVS
VVSHFPDKHPAVHYKDYPLTGIDKLTNSVDLKVFEKRTFYSHFQEFFLLYDWGRQACNFT
LRSDALQQILKRRQGYFDVIIMEQFNTDCMMGVAHQLHAPVIALSSCVMMPWHYERMGAP
IIPSHIPNLFMAQSQDMNFGGRLANWFSFHALNWMYKLLSVPAADKMVQYKFGHMVPSVG
ELAKNTSLFFVNQHYSLSGPKPLPPNVIELGGIHIQKSKPLPADLQRLLDNAEHGVILIS
WGSMIRANSLSAAKRDGIVRAAARLKQQVIWKWENETLPNQPANMHIMKWLPQRDILCHP
NVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALVQRGMATILNYEEIGENSVI
RALKKALDKKYYDAAKAVSHSYNHRPQQALQTALWWVEHVAHTGGAPLLQPSAVHMSRFV
YYSLDCYAVVALILAIIIGSWLALIRRCCGSKSSAKPKRD
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgtcgctgctcaccgtagtgctgttggggctgaccctgggccataccggggtc
gaggtcaatgccggtcccccgctaaagatattgggtctctttccccatcccggcgtcagt
cacttccacttcttccatcccatcatgcggggtctggccgaggcgggacatgatgtcagt
gtggtctcacactttccggacaaacatccggccgtacactacaaggattaccctctaaca
gggattgacaagctcacaaacagcgtggatctgaaggtctttgagaaacgcactttctac
agtcacttccaggagttcttcctactgtacgattgggggaggcaggcctgcaacttcact
ctccgctcggacgcactgcagcagatcctcaagcggaggcagggctactttgatgtgatc
ataatggagcagttcaacacggactgcatgatgggagtggcccaccagctgcatgcgccg
gtgatagctttgagcagctgcgtcatgatgccctggcactatgagagaatgggtgctccg
ataataccctcccacataccgaacttgttcatggcccagtcgcaggacatgaattttggg
ggacggctggccaattggttcagtttccatgccctcaactggatgtacaaattactctcc
gtacccgctgccgataagatggtgcaatacaagtttggccacatggttccctccgtgggt
gagctggccaagaatacctctttgttcttcgtgaaccaacactactccctgagtggaccc
aagccattgccccccaacgtgatcgagctgggcggcatacacatacaaaagtcgaagccc
ttgcccgcggatctgcagcggctcctggacaacgccgagcatggggtgattctcattagt
tggggctccatgatacgcgccaattccctgtccgctgccaagcgggatggcatcgtacgg
gccgcggcacgcctgaagcaacaggtcatctggaaatgggagaacgagacgctgccgaac
caacccgccaatatgcacatcatgaagtggctcccacagcgcgatatcctgtgccatccc
aatgtcaaagtctttatgtcccatggcggtctcatgggcacctcggaggcggcctactgc
ggtgtacccgtcgtggccacacccatgtatggcgatcagtttgtgaacaccgccgccttg
gttcagcgtggaatggccacgatcttgaactacgaggaaatcggggagaacagcgtaata
cgtgccctgaaaaaggcattggacaaaaaatattacgatgccgccaaggccgtctcccat
tcgtacaaccatcgcccgcagcaggctctgcagacggccttgtggtgggtggagcatgtg
gctcacactggcggtgctcccctgctccagcccagcgccgtgcatatgtcccgcttcgtt
tactactccctcgactgctatgcggtcgtggctcttatcctggccattatcatcggcagt
tggctggccctcattcgacgctgctgcggctctaaatcttccgcaaagcccaagagggac
taa

DBGET integrated database retrieval system