KEGG   Drosophila persimilis: Dper_GL23555Help
Entry
Dper_GL23555      CDS       T01063                                 

Definition
(RefSeq) GL23555 gene product from transcript GL23555-RA
  KO
K11252  histone H2B
Organism
dpe  Drosophila persimilis
Brite
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dper_GL23555
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dper_GL23555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 6587310
NCBI-ProteinID: XP_002013132
FlyBase: FBgn0161145
UniProt: B4G2Q7
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaagactagtggaaaggcagccaaaaaggctggaaaggctcagaagaacatc
accaagaacgacaagaagaagaagcgcaagaggaaggagagctatgccatctatatttac
aaagttctgaagcaagtccatcctgacactggtatttcgtcgaaagcgatgagcatcatg
aacagctttgtaaatgacatcttcgagcgcattgctgccgaggcgtctcgcttggctcat
tacaacaagcgctcaaccatcaccagtcgggaaatccaaacggctgtgcgcctgctgctg
ccgggagagctggccaagcacgctgttagtgagggaaccaaggctgtcaccaagtacacc
agctccaagtaa

DBGET integrated database retrieval system