KEGG   Drosophila persimilis: Dper_GL26283Help
Entry
Dper_GL26283      CDS       T01063                                 

Definition
(RefSeq) GL26283 gene product from transcript GL26283-RA
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dpe  Drosophila persimilis
Pathway
dpe00040  Pentose and glucuronate interconversions
dpe00053  Ascorbate and aldarate metabolism
dpe00830  Retinol metabolism
dpe00860  Porphyrin and chlorophyll metabolism
dpe00980  Metabolism of xenobiotics by cytochrome P450
dpe00982  Drug metabolism - cytochrome P450
dpe00983  Drug metabolism - other enzymes
dpe01100  Metabolic pathways
Module
dpe_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dper_GL26283
   00053 Ascorbate and aldarate metabolism
    Dper_GL26283
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dper_GL26283
   00860 Porphyrin and chlorophyll metabolism
    Dper_GL26283
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dper_GL26283
   00982 Drug metabolism - cytochrome P450
    Dper_GL26283
   00983 Drug metabolism - other enzymes
    Dper_GL26283
Enzymes [BR:dpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dper_GL26283
Glycosyltransferases [BR:dpe01003]
 Others
  Hydrophobic molecule
   Dper_GL26283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 6593810
NCBI-ProteinID: XP_002019277
FlyBase: FBgn0163865
UniProt: B4GJF9
AA seq 527 aa AA seqDB search
MVRILLLAVAAVALIGGGQGANILGLFTSLSPSHLIIQMSAAKALAERGHNVTVVTVLEP
AITHKDINLIQVPLSEEDTEHMSRVFEKMGKNNDKNMLFAMFRMFGHMRFMFHKIADALK
DTRVRDLYVNKDNRFDLVLSGFALNDYQMGFAQKLKAPVIVVATLPPSPLFNYLIGNPEE
PSCVPSINDSVEKGKGLSFGQRLSSYLTGIGYKVFSKMGEIQNKKAYKEVFGDDPHMPEY
SEMMKNVSLVFFASHAISEGPIRPNVPGVIEIGGIQIKDTPTPLPPNIEEFVGNATDGAI
LLSLGSNVQGSHLSPDTVQKMFNVLSKLKQRVIWKWEDLDKTPGKSDNILYSKWLPQDDI
LAHPKIKLFINHAGKGGITEAQYHGKPMLSLPVFGDQPANADAMVKKGFGLTQSLLTLEE
QPFREGIEEILSNPTYSQAVSTFSKLYRDRPLTARESVIYWSEYVIRHHGAAHLQSPLMH
MSFVAANNLDVFALLAIILVVFLLLTKAVIKFIIRKLSSKPKKVKKQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgaatcttgttgctagcggtagctgccgtcgccctaatcggtggaggccaggga
gccaacattctgggattgtttaccagcctaagtccctcccatttgatcattcagatgtcg
gcggccaaggctctcgcggagcggggacataatgtcacggtggtcacagtcctggagccg
gccatcacccacaaggacatcaatctgattcaagtgcctctgagcgaggaggatacggag
cacatgagcagagtctttgagaaaatggggaagaacaacgacaaaaacatgctatttgcc
atgttccgtatgttcggacacatgcggtttatgttccacaaaatagccgatgccctgaag
gacacgcgagtgcgcgatctctacgtgaacaaggacaacagattcgatctggtgctgtcg
ggctttgccttgaacgactaccagatgggttttgcccagaagctaaaggctcccgtgatc
gtagtggccaccctgcccccgagccccttgttcaactacctgattggcaacccggaagag
ccgtcctgtgtccctagcatcaatgattcggtggaaaagggaaagggcttgagctttggc
cagcgcctcagcagctacctgacgggcattggctataaggtcttttcaaaaatgggagag
atacaaaacaaaaaggcttacaaagaagtctttggcgatgatccccatatgcccgagtat
tcggagatgatgaagaatgtatccctcgtgttctttgcctcccacgcaatcagcgaggga
cccattcgacccaatgttcccggtgtgattgagattggtggcattcaaatcaaggacacc
cctactccactgcccccgaacatagaggagttcgtggggaacgccacggatggcgctata
ctcctcagtctgggatccaatgtgcagggatcgcatctcagccccgacaccgtccaaaag
atgttcaatgtcctctcgaaactgaagcagagggtcatctggaagtgggaggacctggac
aagacccctggcaagtcggacaacatcctctactccaagtggcttccacaggatgacatc
ctcgcccatcccaagatcaaactattcatcaatcacgccggaaaaggaggcatcactgag
gcccaataccatggaaagcccatgttatcccttcccgtctttggcgatcaacccgcgaac
gccgatgccatggtcaagaagggctttggcctcactcagagtctcctaaccctcgaggag
cagccgttccgcgagggcatcgaggagatcctctcaaatcccacatactcccaggcagtg
tccaccttttccaaactctatcgcgatcgtccactcactgcccgggaatcggtcatctac
tggtccgaatatgttatccgtcaccatggtgccgctcatctccagagtcctctgatgcac
atgagcttcgtagcagccaacaacttggatgtctttgctcttttggccatcattctcgtt
gttttcctgctactgacgaaggctgttattaaattcatcatcagaaagctctcctcgaag
ccaaagaaggtcaagaaacagtaa

DBGET integrated database retrieval system