KEGG   Desulfovibrio piger: DESPIGER_0283Help
Entry
DESPIGER_0283     CDS       T04638                                 

Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
dpg  Desulfovibrio piger
Pathway
dpg00061  Fatty acid biosynthesis
dpg00071  Fatty acid degradation
dpg01100  Metabolic pathways
dpg01212  Fatty acid metabolism
dpg02024  Quorum sensing
Module
dpg_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:dpg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DESPIGER_0283
   00071 Fatty acid degradation
    DESPIGER_0283
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DESPIGER_0283
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dpg01004]
    DESPIGER_0283
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpg04147]
    DESPIGER_0283
Enzymes [BR:dpg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     DESPIGER_0283
Lipid biosynthesis proteins [BR:dpg01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   DESPIGER_0283
Exosome [BR:dpg04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   DESPIGER_0283
  Exosomal proteins of breast cancer cells
   DESPIGER_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: SFV72176
UniProt: A0A1K1LBV1
Position
I:complement(278512..280263)
Genome map
AA seq 583 aa AA seqDB search
MTPELHRPWFSHYEPSVPRTVSVFDQPLYSLLDEAAARYPKRPALIFQNTRLSYKALHEA
VERFAGALRRAGIQPGQRVAVMLPNLPQTMIAFWGVVKCGAVAVMVNPLYMERELLQNLN
DAGAECLILLDMLWPRVAPLRDRLPVRTYVVTGIADALSFPLNLIYRFTKGRQKAVPIPY
DDKVIAWKDFSRGAQPLSEPIADPQHTPALLQYTGGTTGIPKGVALTHSNLGTNCRQILS
IIQETAETGHRFVGLLPFFHVYGLTTGMTIPAALAATVLPLPRYVPQDVLHLIGKHRPTV
FPGAPAIYSSLLQQKTLGQYDLTCIKLCISGSAPLPRDTFRRFQELTGAIILEGYGLTEA
SPITHINPREDSRQKEGSIGMPLPGTDARIVDSESGTAPLPVGKLGELVIRGPQVMQGYW
HLPDETASALRNGWLYTGDLAVMDEEGYFFIMDRKKDMVIVGGYNVYPREVDEVLLEHPD
VLEGVSVGIPDGVRGEALKAYIVPRPGVELTKADIVGWCRQRLASYKVPRLVEFRDELPK
TIVGKVLRRALREEEMARQAQKTARHAARQDAAATPGEDRCDS
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgagctgcaccgtccctggttctcccattacgaaccgtccgttccccgtacc
gtcagcgtcttcgaccagcccctgtacagcctgctggacgaggccgccgcgcgctatccc
aagcgcccggccctgatcttccagaatacccgcctgagctacaaggccctgcacgaggcc
gtggaacgctttgccggcgccctgcgccgcgcgggcatccagccgggccagcgcgtggcc
gtcatgctgcccaacctgccccagaccatgatcgccttctggggcgtggtcaaatgcggg
gccgtggccgtgatggtcaaccccctctacatggaacgggagctgctccagaacctcaac
gacgccggtgccgaatgcctcatcctgctggacatgctctggccccgcgtggcacccctg
cgcgaccggctgcccgtcaggacctatgtggtcaccggtatcgccgacgccctttccttc
ccgctgaacctcatctaccgtttcaccaaagggcgccagaaggccgtccccatcccctat
gatgacaaggtcatcgcctggaaggacttcagcaggggcgcccagcccctgagcgagccc
atcgccgatccgcagcacacccccgcactgctgcagtataccggcggcaccaccggcatc
cccaagggcgtggccctgacccacagcaatctgggcaccaactgccgccagatcctgagc
atcatccaggagaccgccgagaccgggcaccgcttcgtgggcctgctgcccttcttccat
gtctacggcctgaccaccggcatgaccatcccggccgccctggccgccacggtgctgccc
ctgccccgctatgtgccccaggacgtgctgcacctcatcggcaagcaccgtcccacggtc
ttccccggtgcgcccgccatctacagctccctgctgcagcaaaagaccctggggcagtac
gacctgacctgtatcaagctctgcatttccggttccgcgcccctgccccgggacaccttc
cgccgcttccaggagctgaccggtgccatcatccttgaaggctacggcctgacggaagcc
tcgcccatcacccacatcaatccccgcgaggacagcagacagaaggaaggctccatcggc
atgcccctgcccggcaccgatgcccgcatcgtggacagcgaaagcggcaccgcgcccctg
cccgtgggcaaactgggcgaactggtcatccgcggcccgcaggtcatgcagggctactgg
cacctgcccgacgagaccgccagcgccctgcgcaacggctggctctataccggcgacctg
gccgtcatggacgaggaaggctatttcttcatcatggaccgcaagaaggacatggtcatc
gtgggcggttacaacgtctatccccgcgaagtggacgaggtcctgctggaacaccccgac
gtactggaaggcgtgagcgtcggcatccccgacggtgtgcgcggcgaggccctcaaggcc
tacatcgtgccccgtcccggcgtggaactgaccaaggccgacatcgtgggctggtgccgc
cagcgcctggcctcctacaaggtgccccgcctggtggaattccgcgatgaactgcccaag
accatcgtgggcaaggtcctgcgccgcgccctgcgcgaagaagagatggccaggcaggcc
cagaaaactgcccgccacgccgcccggcaggacgctgcggcgacccccggggaggaccga
tgcgactcctga

DBGET integrated database retrieval system