KEGG   Desulfovibrio piger: DESPIGER_1614Help
Entry
DESPIGER_1614     CDS       T04638                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, (R)-and (S)-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
dpg  Desulfovibrio piger
Pathway
dpg00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:dpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DESPIGER_1614
Enzymes [BR:dpg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DESPIGER_1614
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DESPIGER_1614
    1.1.1.-  
     DESPIGER_1614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NADH_4Fe-4S ADH_N_2
Motif
Other DBs
NCBI-ProteinID: SFV73451
UniProt: A0A1K1LFH2
Position
I:1697664..1698713
Genome map
AA seq 349 aa AA seqDB search
MAQEMMRAAVLSGPRRIELKDVPVPPVTPGTLKIRVSTCGVCGSDIHMWQAGRGWSPTPL
EDFHMGHEFCGVVVDSGDTDFRIGERVTFWANLYCGKCDMCRSGQEHLCREVNGARYTGF
VCNGGYAEYFVGRAMNAYRLPDGVSDVAAALIDPLMVAYHAVRRSGLRLHDRVLVVGSGI
IAQLIGGLAKRAGASLLAMSRIDDRQLARAREIGDFDLYFDGTAPDRAQLMREASHGGFD
VVFEAVGSADALSTCLDGVRPGGEVVLIGNSVTPTIPFSLNSVVLHELRLTGSVSCTRRE
FAEAIDLIDSGLINPERYVTAVLPLDHLQAAFEAQVSPKGNVLKTVVQP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggaaatgatgcgggccgccgtactgagcgggccgcgacgcattgagctgaag
gacgtccccgttccgccggtgacacccggtacgttgaaaatacgggtcagcacctgcggc
gtctgtggcagcgacatccacatgtggcaggcgggcaggggctggagccccacaccactg
gaggacttccatatgggccacgagttctgcggcgtcgtggtggacagcggcgacacggac
ttccgtatcggcgaacgcgtgactttctgggccaacctctactgcggcaagtgcgatatg
tgccgcagcgggcaggagcatctctgccgggaagtcaacggcgccaggtacacgggcttc
gtctgtaacggcggctatgcggaatatttcgtgggcagagccatgaatgcatatcgtctt
cccgacggggtttcggatgtggccgctgcgctcatcgatcccctgatggtggcctatcac
gctgtccggcgctcaggactgcgtctgcacgaccgggtactggtggtggggagcggcatc
atagcccagctcatcggcggactggccaaacgagccggggcctctctgctggccatgtcc
cgcattgacgaccgccagctggccagagcacgtgagataggggacttcgatctctatttc
gatggcacggccccggacagggcgcaactcatgcgggaggcctctcatggcggcttcgac
gtggtcttcgaggccgtgggctcggcggatgccctgtccacctgtctggatggtgtccgc
cccggtggtgaagtggtcctgataggcaattccgtaacgcccaccatccctttttccctg
aacagcgtcgtgctgcatgaactacggcttaccggcagcgtctcctgcacgcggcgggaa
ttcgccgaagccatcgatctcatcgactcgggccttatcaatcccgaacggtatgttacc
gctgtcctgcccctggatcatctccaggctgccttcgaggcccaggtatcgcccaaaggg
aacgttctgaaaactgtcgtccagccttaa

DBGET integrated database retrieval system