KEGG   Desulfovibrio piger: DESPIGER_2066Help
Entry
DESPIGER_2066     CDS       T04638                                 

Definition
(GenBank) Phosphopantothenoylcysteine decarboxylase / Phosphopantothenoylcysteine synthetase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
dpg  Desulfovibrio piger
Pathway
dpg00770  Pantothenate and CoA biosynthesis
dpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    DESPIGER_2066
Enzymes [BR:dpg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     DESPIGER_2066
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     DESPIGER_2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: SFV73890
UniProt: A0A1K1LGR6
Position
I:2199653..2200882
Genome map
AA seq 409 aa AA seqDB search
MSASPFRSSRRFAGRRLHLGVCGSIACYKALDLLRALHALDIHVSVTLTDGARRFVTPLL
FEALGAMPVYGRMFEGDEVFDHLEPGQRAQAMLVAPASADALSRLAAGAASDMLSAQALA
FDGPLVVAPAMNPRMWRHPATQDNVATLRRRGAEIVVPGCGGTACGDTGQGRLAPVEDLF
LAALRALSPQDMAGQRVMLTMGPTREKWDGVRYWTNPSSGTMGAALATAAWLRGAGVTAV
CGPGCPDLPAGVERIGVGSAREMFEAASDCWPHMDMGLFCAAVADFSPEPLGPQKFKKEG
RQDGFSIRFTANPDILRTLSQQRREGQKVLGFAAETTPDMESLLELARGKRARKDVDLLA
GNRVNSGDSGFGAATNSMAVVDRTGHEEIWPNQSKADVAWDLCSWLLRL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgtcgcccttccgcagcagccgccgtttcgcgggcaggcgcctgcatctgggc
gtgtgcggctccatcgcctgctacaaggcgctggatctgctgcgcgccctgcacgccctg
gacatccacgtttccgtcaccctcaccgacggcgcgcgccgtttcgtgacgcccctgctc
ttcgaggccctgggcgccatgccggtctatggccgcatgttcgagggcgacgaggtcttc
gatcatctggaaccgggccagcgggcccaggccatgctggtggccccggcctcggccgac
gccctgtcgcgtctggcggccggagcggcgtcggacatgctttcggcgcaggcgctggcc
tttgacgggccgctggtggtggccccggccatgaacccgcgcatgtggcggcatccggcc
acgcaggacaatgtggccaccctgcggcggcgcggggccgagatcgtcgtgcccggctgc
ggcggcacggcctgcggcgataccggccagggccgtctggccccggtggaggaccttttc
ctggccgccctgcgtgccctttcgccgcaggacatggcgggacagcgcgtcatgctgacc
atggggcccacccgcgagaagtgggacggcgtgcgctactggaccaatcccagcagcggc
accatgggcgcggcgctggccacggccgcctggctgcgcggggccggggtcacggccgtg
tgcgggcccggctgccccgacctgcccgccggggtggagcgcatcggcgtgggcagtgcc
cgcgagatgttcgaggccgcgtccgactgctggccccatatggacatgggcctgttctgt
gccgccgtggcggatttctcgcccgagccgctgggcccgcagaagttcaagaaagaagga
cggcaggacggtttcagcatccgcttcacggccaatcccgacattttgcggaccctgtcg
cagcagcggcgggaagggcagaaagtgctgggcttcgcggccgagaccacgcccgacatg
gaaagcctgctggagctggcccggggcaagcgcgcccgcaaggatgtcgacctgctggcg
ggcaaccgcgtcaacagcggtgacagcggctttggcgcggccaccaacagcatggccgtg
gtggaccgtaccggccatgaagagatctggcccaaccagagcaaggccgacgtggcctgg
gatctttgttcgtggcttttgcgcctgtaa

DBGET integrated database retrieval system