KEGG   Pseudodesulfovibrio piezophilus: BN4_11857Help
Entry
BN4_11857         CDS       T02481                                 

Gene name
yiaY
Definition
(GenBank) Fe-containing alcohol dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dpi  Pseudodesulfovibrio piezophilus
Pathway
dpi00010  Glycolysis / Gluconeogenesis
dpi00071  Fatty acid degradation
dpi00350  Tyrosine metabolism
dpi00625  Chloroalkane and chloroalkene degradation
dpi00626  Naphthalene degradation
dpi01100  Metabolic pathways
dpi01110  Biosynthesis of secondary metabolites
dpi01120  Microbial metabolism in diverse environments
dpi01130  Biosynthesis of antibiotics
dpi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN4_11857 (yiaY)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN4_11857 (yiaY)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BN4_11857 (yiaY)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BN4_11857 (yiaY)
   00626 Naphthalene degradation
    BN4_11857 (yiaY)
Enzymes [BR:dpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BN4_11857 (yiaY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CCH49092
UniProt: M1WST6
Position
1947650..1948831
Genome map
AA seq 393 aa AA seqDB search
MAVQEQVYGFFIPSVTLVGIGASKEIPGKIRDLGGKKPLIVTDQGIVKTGILKQITDLLD
DAKMSYEVYDKTIPNPTDANVHEGVDVYKKAKCDSLITLGGGSSHDCGKGIGLVVSNGGK
IHDYEGVDQSTKPLPPYVAVNTTAGTASEMTRFCIITDLSRKVKMAIVDWRVTPGIALDD
PMLMVGMPPSLTAATGMDALTHAVEAYVSTIANPMTDACAEKAIELIFTHLRPAVANGQD
INAREGMCFAQYLAGMAFNNASLGHVHAMAHQLGGFYDLPHGECNAILLPHVEKFNLIAK
VDRFAKLAEIMGENLDGLSPIEAAEKCLVAIRRLSSDVGIPSGLVELGKRYGKEVSPKDI
KVMTGNAQKDACGLTNPRCPTDMDVDEIYKAAM
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctgtacaggaacaagtttatggatttttcattcccagtgtcactctcgtcggcatc
ggtgcttccaaggaaattcccggcaagattcgcgacctgggcggtaagaaaccccttatc
gtaactgatcagggtattgtcaaaacgggtattctgaaacagatcaccgatctgctcgac
gatgccaagatgtcctatgaagtctatgacaagaccatcccgaacccgactgacgccaat
gtccacgaaggtgtcgatgtctacaaaaaagccaagtgcgacagcctgatcaccttgggt
ggcggttcatcccatgattgtggtaaaggcatcggcctggttgtttccaacggcggcaag
attcatgattacgagggcgttgaccagtccacaaagcccctgccgccttacgttgcagtg
aacaccactgccggaacagcttccgaaatgactcgtttttgcatcatcaccgacttgtcc
agaaaggtgaagatggctatcgttgattggcgtgtcaccccaggtatcgctcttgatgat
ccgatgttgatggtcggcatgccgccgtccctgactgccgccaccggcatggatgcgctg
actcacgctgtggaagcatacgtctccaccattgccaaccccatgaccgacgcatgtgca
gaaaaggccatcgaactcatcttcacgcacctgcgcccggcagttgccaacggtcaggat
atcaatgctcgcgaaggcatgtgtttcgctcagtatctcgcaggtatggcgttcaataac
gcctccctgggccacgtccacgccatggctcaccagcttggcggtttctacgacctgccc
catggcgaatgcaatgcgatcctcctgccccatgttgaaaaattcaaccttattgccaaa
gtcgatcgtttcgccaagctggccgaaatcatgggtgaaaacctcgacggtttgtccccc
atcgaagcagccgaaaaatgccttgtggccatccgtagactttcctccgatgtcggcata
ccttccggtttggtcgaactcggcaaacgctacggcaaggaagtcagccccaaggacatc
aaggtcatgaccggcaacgcacaaaaagacgcctgcggtctgaccaacccgcgttgtccc
accgatatggatgtcgacgagatctacaaagcagccatgtaa

DBGET integrated database retrieval system