KEGG   Pseudodesulfovibrio piezophilus: BN4_11935Help
Entry
BN4_11935         CDS       T02481                                 

Definition
(GenBank) Uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dpi  Pseudodesulfovibrio piezophilus
Pathway
dpi00860  Porphyrin and chlorophyll metabolism
dpi01100  Metabolic pathways
dpi01110  Biosynthesis of secondary metabolites
dpi01120  Microbial metabolism in diverse environments
Module
dpi_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN4_11935
Enzymes [BR:dpi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BN4_11935
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BN4_11935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase RPEL
Motif
Other DBs
NCBI-ProteinID: CCH49170
UniProt: M1WM86
Position
complement(2031340..2032845)
Genome map
AA seq 501 aa AA seqDB search
MANVFLVGAGPGDPGMVTLRAKEIIETCDIMIYDYLANVDFLKWCKAECEILYVGKKGGD
HTLPQEKINELIIEKARSGKIICRLKGGDPYVFGRGGEEGEELVEAGIDFEVVPGITAGV
AAPAYAGIPVTHRDHTTSVCFITGHEDPTKSESGNNWAVYGQSNSTLVFYMGVGNLPMIA
KNLMENGRDAETPVALVRWGTRCNQTSFVSTLENVAEEAEKRQWKAPSIIIVGGVCSLHD
KLAWFEKKALLGKGVIVTRAREQASGLVNILQGHGACVHEFPTISVEHLDDYNEVETAIL
QLARYQWVVFTSVNGVKFFWEQLAAIGLDSRIFGGMQIAAIGPATAEELKARGIIPDFVP
EKYVAEHVVEGLLERGIQGQDVLIPRARVAREVLPEELKKVGCNVTVLPVYETKLVQASS
KEIEDAMDKGAINYVTFTSSSTVENFFELVNPDVFRQYPEIKIASIGPVTTKTLERFGFT
PSIEPEDYTIPGLVDALLMDA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtttttctcgtcggagctggaccgggtgatccgggtatggtgactcttcgt
gccaaggagatcattgagacctgcgatatcatgatctacgattatctggccaatgtcgat
tttctgaagtggtgcaaggcagagtgcgaaatcctgtacgtgggcaaaaaggggggagac
cacaccctgccccaggaaaagatcaacgaactgatcatagagaaagcccgtagcggcaag
atcatctgtcgtttgaaaggtggcgatccgtacgtgttcggtcgtggcggcgaagagggt
gaggagttggtggaggccggtatcgatttcgaggttgtgccgggcatcactgccggagtt
gctgcaccagcctatgccggtattccagtgacacaccgcgatcacacgacttcagtctgt
ttcatcaccggccacgaagacccgaccaaaagcgagtccgggaataattgggccgtgtac
ggacaatccaattccacactggttttttacatgggtgtgggcaatctgcccatgattgcc
aaaaatctgatggagaatgggcgggatgccgaaactccggtggcattggtccgatgggga
acccggtgcaaccagacttcctttgtctctacgttggaaaatgtggcggaagaggcggag
aagcggcagtggaaagcaccgtccatcattatcgtgggcggagtctgctccctgcatgac
aaactggcatggttcgaaaaaaaagcattgctgggcaagggagtcattgtgacccgtgca
cgggaacaggccagcggattggtgaatatcctgcagggacatggtgcatgtgtccatgag
ttcccgaccatttcggtggagcatctcgatgattacaacgaggtcgagaccgcaatttta
cagttggcccggtatcagtgggtggtgtttacttcggttaatggggtcaagttcttctgg
gaacagttggccgctatcggactggattcccgaatcttcggtggcatgcagattgcggct
attggcccagctacagctgaagagttgaaggctcgcggtatcattccggactttgtcccc
gagaaatatgtggctgagcatgtcgtggaaggcctgcttgagcgcggtatccagggacag
gatgtcctgatcccgagagccagggtcgctcgggaagtactgcctgaagaattgaagaag
gtcgggtgcaacgtgactgtcctgcccgtctacgagaccaaattggttcaggccagcagc
aaggagattgaggacgccatggacaagggcgcgatcaattatgtaaccttcacgtcgtca
tcgacagtagagaacttcttcgagttggtgaatccggacgttttccggcaatacccggag
atcaaaatcgcttccatcggtcctgttacgacgaagaccctggagcggttcggttttact
ccgagcattgagcctgaagattatactatacccggattagtggatgcattgctgatggat
gcatga

DBGET integrated database retrieval system