KEGG   Pseudodesulfovibrio piezophilus: BN4_12119Help
Entry
BN4_12119         CDS       T02481                                 

Gene name
purE
Definition
(GenBank) N5-carboxyaminoimidazole ribonucleotide mutase
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
dpi  Pseudodesulfovibrio piezophilus
Pathway
dpi00230  Purine metabolism
dpi01100  Metabolic pathways
dpi01110  Biosynthesis of secondary metabolites
dpi01130  Biosynthesis of antibiotics
Module
dpi_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dpi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BN4_12119 (purE)
Enzymes [BR:dpi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     BN4_12119 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC PrpR_N Aldolase
Motif
Other DBs
NCBI-ProteinID: CCH49354
UniProt: M1WR59
Position
2253591..2254073
Genome map
AA seq 160 aa AA seqDB search
MPQVVIFMGSISDEEKMRPCSDLFKELGVDHVFTISSAHRTPERTARLVKEYEETGCQVF
ICAAGLAAHLAGAVAAQTIKPVLGVPLTASAFGGMDAMMATVQMPPGFPVGTVALDKVGA
KNAAWLAAQILALQDEELASKIHKARQGFVESVEKAAASL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggttgtcattttcatgggttccatttccgatgaagaaaagatgcgtccgtgt
tccgacctgttcaaagaactgggtgtggatcatgttttcaccatttcatcagcgcaccga
accccggagcggactgcacgactggtcaaggagtacgaagaaaccggttgtcaggtcttc
atctgtgcagccggactggccgcgcacctggccggagcggttgctgcccaaaccatcaag
cctgtccttggcgttcccctgacggcttcggccttcggcggcatggatgccatgatggcc
accgtacagatgcctccgggattcccggtcggcaccgtggctttggataaggtcggcgcg
aaaaacgcagcgtggctggccgcacagattctcgcccttcaggatgaagaactcgcctcc
aagattcacaaggcccgccaaggatttgtggagtctgtagaaaaggccgccgccagtctc
tag

DBGET integrated database retrieval system