KEGG   Pseudodesulfovibrio piezophilus: BN4_20346Help
Entry
BN4_20346         CDS       T02481                                 

Gene name
bdhA
Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
dpi  Pseudodesulfovibrio piezophilus
Pathway
dpi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:dpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BN4_20346 (bdhA)
Enzymes [BR:dpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BN4_20346 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BN4_20346 (bdhA)
    1.1.1.-  
     BN4_20346 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C ADH_zinc_N_2 PALP DAO 2-Hacid_dh_C AdoHcyase_NAD Pyr_redox_2 AlaDh_PNT_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: CCH50408
UniProt: M1WYL2
Position
3472095..3473171
Genome map
AA seq 358 aa AA seqDB search
MSETMRAAVWHGKQDVRVETVPVPPSPSAGWVKIKVDWCGICGSDLHEFVAGPVFIPTDA
PHPLTGKQGSVILGHEFTGTVVEVGEGVTNVSVGDFVAPDACQHCGECITCRAGRYNVCE
KLAFTGLHNDGAFAKYVNIPSELCYILPNGISSEAGALIEPLATGYKAVREAGSILGETV
VIIGAGTIGLGTLMAARAAGAGMIIVLEMSTVRAAKAKECGADVVLNPNECDPVAEIKAL
TQGSGADVSFECVGNKFTGPLAVDVLRNAGRAIIVGIFEESSSFNFFSLSGTDKRVIGTL
AYTLSDFQGVSTLLANGQLKAEPMITGRIHLEDIVEKGFWELINNKDENIKIIVSPGD
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaacaatgcgagctgccgtgtggcatggaaagcaggatgtccgtgttgagacc
gttccggttcccccttctccatcagccggttgggtcaagatcaaagttgattggtgtggt
atctgcggttcggatttgcatgagttcgtcgccggtccggttttcattccgactgatgct
ccgcatcccctgacaggaaagcagggcagtgtcatcctcggtcatgagtttacgggaaca
gtcgtggaagttggcgagggcgtcaccaatgtgagtgtcggtgattttgtggcacctgat
gcctgtcagcattgtggcgaatgtatcacatgtcgtgccgggcggtacaacgtctgcgag
aagctggccttcacagggctgcataatgatggtgcttttgcaaaatatgtgaatataccc
agcgaactctgctatatattaccaaatggtatttcctctgaggcgggggcgttgatcgaa
ccgctggcaacagggtacaaagccgtgcgtgaagctggctccattcttggagagacggtt
gtcataatcggggcagggaccattggtttagggactctgatggcagccagagcggcaggc
gcgggtatgataatcgtgctggaaatgtcaaccgtccgggctgcaaaggccaaggaatgt
ggggctgatgttgttcttaatccgaatgaatgcgaccctgttgctgaaataaaagctttg
acccaagggtcaggtgcggatgtttctttcgaatgtgtcggcaacaaattcaccggacca
cttgccgtggatgtgcttcgtaatgcagggcgggcgatcattgtcggtatttttgaagaa
tccagttcattcaattttttcagtttaagtgggacagacaaacgcgttataggcaccttg
gcttatactttgagcgattttcagggtgtttcgaccctgctggcgaacgggcagctcaag
gctgaacccatgattaccggtcggatacatcttgaagacattgtggaaaaaggcttttgg
gaattgatcaataacaaggatgagaacatcaagattatcgtcagtccaggagactag

DBGET integrated database retrieval system