KEGG   Danaus plexippus (monarch butterfly): KGM_200271Help
Entry
KGM_200271        CDS       T04344                                 

Definition
(GenBank) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00040  Pentose and glucuronate interconversions
dpl01100  Metabolic pathways
Module
dpl_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KGM_200271
Enzymes [BR:dpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     KGM_200271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind 2-Hacid_dh_C Sacchrp_dh_NADP Shikimate_DH THF_DHG_CYH_C NAD_binding_7 ApbA FMO-like 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: OWR42712
UniProt: A0A212ET48
Position
Unknown
AA seq 244 aa AA seqDB search
MKISFEGKRVLVTGAGQGIGRGIAIELWKAGAKVVAVSRTQSHLDSLHAQYPSIDVVALD
VGDYDKTRQVIDDLGHFDALVNNAAIANCQPFLECSPDVFDRMVNINVKSVINISQVVAR
KMIEKKIAGAIVNVSSQASKKALKNHTIYGATKAALDSVTRTMALELGPYGIRVNAVNPT
VIMTEMGKTEWSDPIKANAMLSRIPLDRFGEVSEVSDAVLYLLSDKASMINGVELPIDGG
FLAA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatcgtttgaaggaaaacgagttttagtgacgggtgctggccaaggaatcggt
cgtggtatagccatagaactatggaaagcaggtgccaaagtagtagctgtgtccaggacg
caatcacacttagacagtcttcacgcgcaatacccatctattgatgtggtggctttggat
gttggagactatgataagacccgacaggttatagatgatctgggacattttgatgcgtta
gtcaacaatgcggctatagcaaattgtcaaccatttttagagtgttcaccagatgttttt
gatagaatggtcaacataaatgtcaaatccgttatcaatataagtcaagttgtggctaga
aagatgatagaaaagaaaatagctggtgcgatcgtcaatgtttcttctcaagcatcgaag
aaagcattaaaaaatcacacgatatacggcgcaacgaaagctgcattagattctgtaacc
cgtaccatggctctggagctaggaccctacggcatcagagttaacgcggtcaaccctaca
gtcattatgactgaaatgggcaaaacagaatggtctgatccaattaaagctaatgctatg
ctttctagaatacccttggatagatttggagaagtatccgaagtgtcagacgcggtgctc
tacttactgagtgacaaagcaagtatgatcaatggtgttgagttgcctatcgacggaggt
ttccttgctgcgtag

DBGET integrated database retrieval system