KEGG   Danaus plexippus (monarch butterfly): KGM_200272Help
Entry
KGM_200272        CDS       T04344                                 

Definition
(GenBank) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00040  Pentose and glucuronate interconversions
dpl01100  Metabolic pathways
Module
dpl_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KGM_200272
Enzymes [BR:dpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     KGM_200272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase RmlD_sub_bind Sacchrp_dh_NADP THF_DHG_CYH_C NAD_binding_7 ApbA Methyltransf_34 Shikimate_DH TrkA_N ParD_antitoxin
Motif
Other DBs
NCBI-ProteinID: OWR42711
UniProt: A0A212EMP4
Position
Unknown
AA seq 244 aa AA seqDB search
MEISFKGKRILVTGAGQGVGRGIAVELWRAGANIVAISKTRSHLESLQSEYPSIDIVDVD
ISDWEKTREVIDSLGHFDALVNNAAVAICEPFLTCSPNDFDRMFDVNVKAVLNISQVVAK
KMIDNKTQGAIVNISSQASKAALKDHAIYSASKAALDSLTRVMALELGAYGIRVNAVNPT
VIMTAMAKVGWSDPVKSSEMISKIPLGRFGEVSEVVNAVLFLLSDKSSMINGVQLPIDGG
FLAT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggaaatctcttttaaaggaaaacgtattttagtcaccggcgcaggacaaggcgtcggt
cgcggtatagctgtagaattatggagagctggggcaaacatagtcgcaatttctaagacc
agaagccatttggagagtttgcaaagcgaatatccttcaattgacatcgtcgatgttgat
attagcgattgggaaaagacaagggaagtaattgactctctaggtcattttgatgcatta
gtaaacaatgcagcggttgccatttgtgaacctttccttacttgttcaccaaatgatttt
gacaggatgtttgatgtgaacgtgaaagcagtactaaacataagccaagttgttgctaaa
aagatgattgataacaaaactcaaggcgccatagtcaatatatcttctcaggcctcaaag
gcggccttgaaagatcatgccatttacagtgcatccaaagcggcattagattctctaact
cgtgtcatggcattagaattaggggcatatggaataagggtaaatgctgtaaacccgacg
gtcattatgactgcaatggcaaaagttggttggtctgaccctgtgaaaagttcagaaatg
atatctaaaataccacttggaagatttggggaggtttcagaagtagttaatgctgttctt
ttcctcttgagcgataagtccagcatgatcaatggtgtgcaattacccatcgatggaggt
tttcttgctacctag

DBGET integrated database retrieval system