KEGG   Danaus plexippus (monarch butterfly): KGM_202413Help
Entry
KGM_202413        CDS       T04344                                 

Definition
(GenBank) putative 2-deoxyglucose-6-phosphate phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
dpl  Danaus plexippus (monarch butterfly)
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpl01009]
    KGM_202413
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     KGM_202413
Protein phosphatases and associated proteins [BR:dpl01009]
 HAD phosphatases
  Other HAD phosphatases
   KGM_202413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: OWR50114
UniProt: A0A212F8Q0
Position
Unknown
AA seq 215 aa AA seqDB search
MDGLLLDTEQVYKKMITQLCAKYGHEYTEELMMKVLGGTEQRLSEILCKDLNLPVTPTEF
RDELLEMGDKMLAGTPLLDGAERLICHLHKTKVPFALATSSSERSVKTKIASYRELFSYF
NHMVMGSTDKEVKFGKPHPDIFLVAASRFPDKPKPEKCLVFEDSPHGVTAGVKAGMQVVM
VPDPHLDKRLTTHATIVLPTLAKFQPEMFGLPPFQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggacggcttgcttttagacaccgagcaagtttataagaagatgataacacagctttgt
gctaaatatgggcatgaatatacagaggaattaatgatgaaagttttaggaggaactgag
cagaggttatcggaaatactatgcaaggatttaaatctgcctgtaactcctacagaattt
cgagacgagttgttagaaatgggtgataaaatgctggcgggaactccactattagatggt
gctgaaagattaatctgccatcttcataaaacaaaagtgccatttgctctagcaacatca
tccagtgaaaggtcggtaaagactaaaatagcctcatatagagaactcttcagctacttt
aatcacatggtcatgggcagcacggacaaggaagtcaaatttggcaaaccccatcctgat
atattccttgtggctgcatcacgtttcccggacaaaccaaaaccagaaaagtgtttagta
ttcgaagattctcctcatggggttacagcaggagtgaaggcgggtatgcaagtggtcatg
gtacctgatcctcacctggacaaaagactgacgacccatgctactatagtgctgcctact
ttagcaaagttccaaccagaaatgtttggtctacccccatttcagtga

DBGET integrated database retrieval system