KEGG   Danaus plexippus (monarch butterfly): KGM_203952Help
Entry
KGM_203952        CDS       T04344                                 

Definition
(GenBank) sulfhydryl oxidase 1 like protein
  KO
K10758  thiol oxidase [EC:1.8.3.2]
Organism
dpl  Danaus plexippus (monarch butterfly)
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KGM_203952
Enzymes [BR:dpl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     KGM_203952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Evr1_Alr FAD_SOX QSOX_Trx1
Motif
Other DBs
NCBI-ProteinID: OWR50415
UniProt: A0A212F9J4
Position
Unknown
AA seq 452 aa AA seqDB search
MAYPSLRYLHENYVKGNSNVGEKFQSAESAAKLKDQMIFKIQNEQQAGQLKHAPSLDIDS
PANIQTMPTPSGVTYTFLIFESPNSTIGSEIVLDTSDYTNILIKRVSDSSKLAESIGVKT
FPAVAVVGPSRTPNILNPGTPTKSNILKTINTYLRSQNFVFPKHLEFEDVDELNALKNKD
LSSMSADAVFYSDLEKTLKTSLHTEITRHKVLDGEPLEALLDFLNVLITAFPFRANMEEY
ILELHNKLSSKSSWNGNEVYELVKKLEASHAPVFSTNADYIRCKGSQSKYRGYTCGLWTL
FHVLTVNAARKPGYEAPHVLRAMHGYVKHFFGCTECSQHFQAMAARNRLFDVKENDKAVL
WLWISHNEVNLRLAGDVTEDPAHPKIQYPSVTNCPDCRLSRGAWNLPAVFEYLQKIYGAN
NIHDARSIASAAASPGPFSDLDIGMLSLLYMS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcttatccttctttacgttatttacacgaaaactatgtgaagggtaattccaatgta
ggtgagaagtttcaatctgctgaaagtgctgcaaaattaaaagatcaaatgatattcaaa
atacaaaatgaacagcaagctggacaattaaaacatgccccttctttggatattgattct
ccagccaacattcaaacaatgcccactccatctggagttacatacacatttttaattttt
gaatctcccaattcaactattggctcagaaatagttttggataccagtgactatactaat
atattgatcaaaagagtatctgattccagtaagttggcagaaagtattggtgttaaaact
tttcctgcggtggcagttgttggaccttcaagaactcccaatattctcaaccctggaact
ccaacaaaatctaatatactcaaaactattaatacatatttaaggtcacagaattttgta
tttcctaagcaccttgaatttgaagatgtagatgaattgaatgctttaaaaaataaggat
ttaagttccatgtctgcagatgctgttttctatagtgatctggaaaaaactttaaaaact
agtttgcatactgaaattacgaggcataaagttctagatggtgaaccacttgaggcccta
ttggattttttaaatgttttaataacagccttcccctttagagccaatatggaagagtat
atacttgaattacacaacaaacttagctcaaaaagttcatggaacggaaatgaagtatat
gaattagtaaaaaagttagaagcttctcatgcaccagttttctcaaccaatgcagattat
atacgatgcaagggtagtcaaagtaaatatcgaggctatacttgtggattatggactttg
ttccatgttctaactgtaaatgcagcaagaaaaccaggatatgaagccccacatgtttta
agagctatgcatggttatgtcaaacatttctttggttgtactgaatgttcccaacacttc
caggccatggcagctagaaataggttgtttgatgtcaaagaaaacgataaagcagttctc
tggttatggatttctcacaatgaagtcaacttgagattggcaggagatgtaaccgaagac
cctgctcatccaaaaatacagtatccaagtgtcactaactgtccagactgtagactttca
cgaggagcttggaatttgcctgcagtttttgaatatttgcaaaaaatatatggtgctaac
aacattcatgatgcaagatcaatagcctcagcagccgcctctcctgggccattctccgac
ctggacattggaatgttaagcctcttgtacatgtcgtaa

DBGET integrated database retrieval system