KEGG   Danaus plexippus (monarch butterfly): KGM_204127Help
Entry
KGM_204127        CDS       T04344                                 

Definition
(GenBank) activin receptor type-2B like protein
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    KGM_204127
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpl01001]
    KGM_204127
Enzymes [BR:dpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     KGM_204127
Protein kinases [BR:dpl01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   KGM_204127
Cytokine receptors [BR:dpl04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   KGM_204127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp APH FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: OWR42610
UniProt: A0A212EM83
Position
Unknown
AA seq 547 aa AA seqDB search
MARKIILYMSLVLLGIHGTTVKTYAAPPSDDNLPPRPKEGGVETRYCEFYNNSLPQNCGS
QNKTCPPAPVIREECQPIEADKSNHCFVLWYYDNTTNTVTVKVKGCFLDTVACNDRASNC
RIHNQKLPLLHCCCEGDMCNENATFPGLEAGMSSQTELPPERVPASPLPTSDDDTRAVIA
YTLTPLFLLFAVLVACYLLYRKRKGSSFAELGNGEASLSRPPSASAGMENETGILLGQIT
LCEVRARGRFGAVWRAKLGQRDVAVKVFPLQDKQSWLAEQEIYRLPRMDHQDILHYIGVD
KKGDNLQAEYWLITAYHEKGSLCDYLKSHTLSWNEAWRVAACVARGLAHLHEEEGGKPAI
AHRDFKSKNVLLKNDLSACIADFGLALVFVAGHGCGDAHGQVGTRRYMAPEVLDGAINFT
KDAFLRIDMYACALVLWEIASRCSDSGVEPTAQYRLPLEEEVGSHPGLEEMQEAVVQRKL
RPHIQPQWRDHPGLSVLCDTMEECWDHDAEARLSASCVLERIAAQQPAQPTPQTPDTTPL
LIHELTC
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggctcggaagattatattgtatatgtctctagtgctactgggtattcatgggacgacg
gtaaagacctatgctgcaccaccatcggatgataacctaccacctcgccccaaggagggt
ggggtggaaacgagatattgcgaattctataataactcgctaccacaaaattgtggttca
caaaataagacatgtcccccagcaccggttataagagaggaatgccagcctatagaggcg
gataaaagcaatcactgcttcgttttatggtactacgacaacacaacaaatacggtcacg
gtcaaggtcaaaggctgcttccttgacaccgtggcctgcaacgatagggcttcaaactgc
agaatccacaatcagaagcttccccttctccactgctgctgcgagggtgacatgtgcaac
gaaaacgcaaccttcccaggactagaagctggaatgtcatcgcaaacagaactaccgcca
gagagagtaccggcgtctcctttgccaacatcagacgatgatacaagagctgtcatagca
tacacactaacgcccttatttctgctattcgctgtgctggtggcatgttatctattgtat
aggaaacgtaaaggcagctcgttcgctgagctcgggaacggtgaggcgtcgctatcgaga
ccgccatccgcatcagcggggatggagaacgagacgggtatacttctgggtcagataacg
ctatgtgaggtgcgggcgaggggtaggttcggggcggtttggagagcaaaacttggccag
cgtgatgtagcggtgaaggtattcccgctccaggacaagcaatcctggctggcggaacaa
gaaatatacagactcccacgtatggaccatcaagacatattacattatatcggagtcgac
aagaagggagataatctgcaagctgaatattggcttataacggcctatcatgaaaagggt
tctctttgcgactatctcaaaagccacacattatcatggaatgaggcgtggcgcgtcgcc
gcatgtgtggcgcgagggttggcacacttacacgaggaagaaggagggaaacccgccata
gcacatcgtgacttcaaatccaaaaatgtcttactgaagaacgatttaagtgcctgcatc
gctgacttcggcttagctttggtgtttgttgctggtcatggttgcggtgacgcgcacggc
caagtcggtacgagacgttacatggcgccggaagtgcttgatggggcgatcaatttcaca
aaggacgccttccttaggatagatatgtatgcgtgtgcgcttgtcctgtgggagatcgcg
tcacgttgtagcgacagcggcgtagaaccgacagcccagtaccgtctaccactggaggag
gaagtgggttcgcatcccggactggaagaaatgcaagaggctgtagtccaacgtaaatta
cgaccacatattcaacctcagtggagagaccacccgggtctgtcagtgctgtgtgatacg
atggaagaatgctgggatcatgatgctgaagctcgtctatcagcttcctgcgtgctggaa
aggatcgcggcccagcaaccggcacaaccgacacctcagacaccagacacaaccccgcta
ttgatacacgagctgacctgctga

DBGET integrated database retrieval system