KEGG   Danaus plexippus (monarch butterfly): KGM_205097Help
Entry
KGM_205097        CDS       T04344                                 

Definition
(GenBank) putative guanylate cyclase
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00230  Purine metabolism
dpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KGM_205097
Enzymes [BR:dpl01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     KGM_205097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr ANF_receptor Pkinase HNOBA GSAP-16
Motif
Other DBs
NCBI-ProteinID: OWR49210
UniProt: A0A212F645
Position
Unknown
AA seq 1304 aa AA seqDB search
MCHGARVLLLAALGLLAVPSVAVPLKKYNITVGYLPSIKGEQRDRQGLAISGALSMALED
INNSTQLLPDVRLLLEWNDTKCDEVTATRLLTHMSCSGVVAFFGPEGRCQTEAIIAQSRN
LPMIAYKCSDYQTSKLSTFARLEPPDTQATKSVISLLRYYRWNKFSILYEESWVTVALTL
ENHAKKNNMTVNHQRPVIDGFKCCEEKMACCAPGFWYQFIQETKNRTRIYVFLGSTAGLI
EMMTAMESLQLFVKGEYMVIFVDMMTYSPKDSLKYLIKTEDRGSKLVCHNTPEFHKRAQS
LLVVVSSEPEGSYEYFTSRVRIYNSMKPFEFPLPAVFTHRFNKYVSIYAAYLYDSVKLYA
TALHQIIEEETTYKNETLTYEKLQSIVTNGTHIVAKMISTTPFNNYIDFLYIIVVPTLVL
KYVYIFFCYQRLIHYRMQEYKLNSKLPIDWPDSVKPEDEPSCGFLNEKCPKDDSQITSLV
VAGTLGVTLFCALVVTISIYRKWKIEQEIEGLLWKIDPQDIDGYLGSGLICSPSKLSVAS
GMSYESKGWTQIFAPTAQYRGNMVRIKELKFTKKKDICREVMKEMRLLRELRHDNLNSFI
GAVVEPLRVLLITDYCAKGSLYDIIENEDIKLDKMFISSLVHDLIKGMIFIHSSPLVFHG
NLKSSNCVVTSRWMLQVSDFGLHELRCCAENEYIGEHQYYRGLLWKSPELLRQLGDPNGT
VGSQKGDVYAFGIILYEIIARRGPFGATSLEPKDIVERVKRGRRGCEESFRPDTRALDVE
EYVISCMRDCWAEDPVLRPDFPAVRARLKRMKSGKSRNIMDQMMDMMEKYANNLEELVNE
RTRLLFEEKQKTEDLLHRMLPESVAHRLTTGEGVEPESFDSVTIYFSDIVGFTAMSAEST
PLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIRNNDRHVGEIASMALELL
NAVKTHKISHRPNEILKLRIGIHTGAVVAGVVGLTMPRYCLFGDTVNTASRMESNGEPLR
IHISPSCKIALDKLGGYIVEPRGTIPIKGKGQLQTFWLVGATEKAIQKRPVEGEERPLFC
RPRRSPRLTDSRHPSISEYAKRSCVGCAELKPLVRRAALAAHAANTKRALSSIASSTACE
GAGAMCPETGPLSCGAAAGVGAALRPARSLDVLPARERLRRHYTTRSLDVDVAIATVSSS
LYNGAALVPPDEPPRADEDSPLLRQASLCNKLDRPKRKVPDSDFIEFYKKWRSLENVADS
KGAKIPRFAIRSWLRGIFGGGGGARSTSSSLRRAPQLVDRESAV
NT seq 3915 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcacggcgcgcgggtgctcctactcgcggcgctggggctgctggccgttccttcg
gtcgccgtccccctgaagaagtacaacattacagtcggttacctaccttccatcaagggg
gagcagagagacaggcagggtctcgctatatccggcgctctctctatggcgctggaagac
atcaacaacagcacacaactgcttccggatgttcgtctgttgttggaatggaacgataca
aagtgtgacgaggtgacggctactcgtctgttgacacacatgagctgttcaggtgtcgta
gctttcttcggaccagagggacgttgtcagaccgaggccataatagctcagtcaagaaac
ctaccaatgatcgcttataaatgttctgattatcaaacatcgaagttatctaccttcgca
agactcgaaccgcctgacactcaggcaacgaaatccgtgatatccttactgaggtactat
agatggaacaaattttcaatattgtacgaagagtcgtgggtgacggttgctctgacgttg
gagaaccacgcgaagaagaacaacatgacagtgaaccaccagagaccggtcatcgatggg
tttaagtgctgtgaggagaagatggcctgctgtgctccagggttctggtaccaattcata
caggagaccaagaatagaactagaatatatgttttcttggggtcgactgctggattaata
gaaatgatgactgcgatggagtctctacagctgttcgtgaaaggagagtacatggtcata
ttcgtagacatgatgacatacagtccaaaggattcgctgaagtatttaataaaaaccgag
gaccgcggttcgaagctggtgtgtcacaatactccggagttccacaagcgggcgcagtcc
ttactcgtggtggtgtcctcggagccggagggcagctacgagtacttcacgagtcgtgtg
cggatctacaacagtatgaagcccttcgagttcccgctgccagctgtcttcacacatagg
ttcaacaagtacgtttccatctacgcggcgtatttgtacgactctgtaaagctgtacgcg
acggcgctccaccagatcatcgaagaggagaccacgtacaagaatgaaacgcttacatat
gaaaaattacaaagcattgttaccaacggtacacatatcgtcgcaaaaatgatttcaacc
acaccattcaataattatatagattttttatatattatcgttgtacccacattagtacta
aagtatgtatatatatttttctgttatcaacgcctcattcactatcgtatgcaggaatat
aaattgaattcgaaactgccaatcgactggcccgacagcgtgaagccggaagacgagcct
tcctgcggcttcctcaacgagaagtgccccaaagacgactcacaaataacatcattagtg
gtggccggcacattgggagtgacgttgttctgcgccttggttgtcactatcagtatatac
aggaagtggaagatagaacaggaaatcgaagggttgctgtggaagatcgacccccaggac
atagacggatacttgggcagtggactcatctgttcaccgagtaagttaagcgtggccagc
ggtatgtcatacgagagcaaaggttggacacaaattttcgcgccgacggcacagtataga
gggaatatggtcaggataaaagaactgaagtttactaagaaaaaggacatctgccgcgag
gtgatgaaggagatgcgtctcctccgcgagctccgtcacgacaacctcaactcattcatc
ggagccgtggtggagccgctcagagtgttgctcatcaccgactactgcgccaagggtagc
ttgtatgatataatagagaatgaagatatcaagttggataagatgtttatatcttcattg
gttcatgatctcattaagggtatgattttcattcactcctcgccgttagttttccacggg
aatctcaagtcctcgaattgcgttgtcacgtcacgttggatgttacaggtatccgatttt
ggtttgcatgaattgcgatgttgcgctgaaaacgagtatattggggaacatcagtactat
agaggtctgttatggaagtctccggagctgttgagacaactgggtgaccccaacggtact
gtaggctcgcagaaaggtgatgtgtacgcgtttgggatcatactgtacgaaataatcgct
agaagaggaccttttggagcgacgtcactagaacctaaagatatagtggagcgtgtgaag
cgcggccgtcgcggctgtgaggagtccttccggcccgacacacgtgctctggacgtggaa
gagtacgtgataagttgtatgagggattgctgggccgaggatcccgtactacgaccagat
ttcccagcagttcgcgccaggctcaagaggatgaagtccggcaagtccaggaacataatg
gatcaaatgatggatatgatggagaagtacgcgaataatttggaagaactagtcaatgaa
aggaccaggctactgtttgaggagaagcagaagacagaagacttgctgcacaggatgttg
ccagagtcggtcgcacaccggctgactacaggcgagggtgtggagccggagtcgtttgac
tccgtgaccatatacttcagcgacatagtcggcttcacggccatgtccgcagagagcact
ccgctacaggtcgtcaacttcctcaacgatctctacacagtgtttgacaggatcataaga
ggctacgacgtctataaagtggaaactataggggacgcttacatggtggtatctggtctt
ccaataagaaacaacgacagacacgtcggtgaaatagcatcgatggcgttggagctcctt
aacgccgtgaagactcacaaaatatcacacagaccgaacgaaattttgaaattaagaata
ggaatacacacaggtgcggtggttgccggcgtggtgggcctgaccatgcctcgctactgt
ttgttcggcgacacagtgaacacggcctcccgtatggagtccaacggggagcctctccgt
atacacatctcccccagctgtaagatagctctggacaaactgggcgggtacatcgtggag
ccacgaggaactatacctattaagggcaaggggcagttgcaaacgttctggctggtgggc
gcaaccgagaaagctattcagaagcggccggtggagggagaggagcgaccgctgttctgt
cgaccgagacgaagtccacgtttgactgattctagacatccttctatctctgagtatgct
aagcgttcatgtgtgggttgcgcagagctgaagccgctcgtacgacgcgccgcgctcgcc
gctcacgccgccaacaccaagcgagcattgagttccatcgcgtcgtcgacggcatgtgag
ggagcgggcgccatgtgtccggagacgggtccgttgtcttgtggggcggcggcgggggtc
ggggccgcgttgcgtcctgctcgctcgctggacgtacttccggctcgcgagcgtctgcgt
cggcattacacgacccgctcgctcgacgtggacgtggccatcgccaccgtctcctcgtct
ctgtacaacggcgccgccctcgttcctccggacgagccaccgcgtgctgacgaggacagc
ccgctgctgcgacaggcgagcctctgcaacaaactggaccgccccaagcgcaaggtgccc
gactctgacttcatagagttctacaaaaagtggcgctcgctcgagaacgtcgcggactcg
aagggtgccaagatccctcgtttcgcgatccgctcgtggctgcgaggcatcttcggcggc
gggggcggcgctcgcagtacgtcctcgtccttgcgtcgcgcgccccagctggtcgaccgg
gagtccgccgtctag

DBGET integrated database retrieval system