KEGG   Danaus plexippus (monarch butterfly): KGM_206114Help
Entry
KGM_206114        CDS       T04344                                 

Definition
(GenBank) NADPH cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dpl  Danaus plexippus (monarch butterfly)
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KGM_206114
Enzymes [BR:dpl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     KGM_206114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-ProteinID: OWR41297
UniProt: A0A212EIJ2
Position
Unknown
AA seq 683 aa AA seqDB search
MSDNTQDILKEAAAAAAVGGSLFSTFDIIMLIFLFGAALWWLYSSRKENKKDDLLLSKYS
IQPAGSIQITENSFIKKLQSSGRSLVVFYGSQTGTGEEFAGRLAKEGIRYKMKGMVADPE
ECDMEELTKLRDIENSLAVFCLATYGEGDPTDNAMDFYEWLKSGDPDLTGLNYAVFGLGN
KTYEHFNSVAIYVDKRLEELGATRVFELGLGDDDANIEDDFITWKEKFWPAVCEKYNIEN
TGEEELTRQFRLVTHAPDEITPNEVFTGEIARLHSFQNQRVPFDAKNPFLAQIIVNKELH
KGGDRSCLHIELDISNSKMRYEAGDHVAVYPINDRGLVERLGVLTGADLDEVFSLINTDQ
ESTKKNPFPCPTSYRTALSHYIEITALPRTHILRELAEYCMEDEDKNKLLLMATNSQEGK
ALYQSFIVDSCRNIVHILEDLKSCKPPLDHLCELLPRLQPRYYSISSSPKLYPETVHVTA
VVVKYETPTGRLNKGVTTTWLAENKPEPGKPFPRVPIYIRKSQFRLPLQTQTPVLMVGPG
TGLAPFRGFLQERSHARINGKEVGDTILYFGCRHRDQDYIYQEELEEFERNGDVTLHVAF
SRDQPKKVYVTHLLENNLEQIWDVIGNRNGHFYICGDAKNMAVDVRNIVIKAVQEKGGRS
EAEAVQFLKKLESMKKYSADVWS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaatactcaggatatcctcaaggaagcagcagcagcggctgctgttggtgga
tctttgtttagtacatttgatataattatgcttatatttctattcggagcggctctttgg
tggctttacagttccagaaaggagaataaaaaggatgatttacttcttagcaaatattca
attcagccagccggttctatacaaattacagaaaattcttttattaagaaattgcaatca
tctggaagaagtctagtggtattttatgggtctcaaacaggtaccggggaagagttcgca
gggcgattagccaaagagggtatacgttacaaaatgaaaggaatggtagccgaccctgaa
gagtgtgatatggaggaattaacaaagctgagagatatcgaaaactccttagcagtattt
tgtttagcaacatatggtgaaggagaccctacagataacgctatggacttctatgaatgg
ttaaaaagtggtgatccggacctaacaggactaaattacgcggtatttggcctgggtaat
aagacatatgaacattttaactcagtcgcgatctatgtagacaagcgtctagaagaactt
ggagctacaagggtatttgaacttggtctcggagatgatgatgctaatattgaagatgat
ttcatcacttggaaggaaaagttttggccggctgtttgtgaaaagtataatattgaaaat
acgggtgaagaggagctgacacgccaattccgacttgtaacacacgctcctgatgaaata
actcccaatgaagtttttactggagaaattgctcggttacattccttccagaatcagaga
gtgccatttgatgctaaaaatcctttcttagctcaaataattgtgaataaagaattgcac
aaaggtggtgataggtcatgtctgcacattgaattggatatttcaaactcaaagatgaga
tatgaagcaggtgatcatgtggctgtgtatccaattaacgatagaggtctagtagaacgt
ctcggggtcttaacgggtgctgatctggatgaagtgttctctctaatcaacaccgatcag
gaaagcactaagaagaatccattcccatgccccacatcataccgaactgcactatcacat
tacattgaaataacagcattgccgaggacccacattttacgggagcttgctgaatactgt
atggaagatgaggataagaataagttactattgatggcgaccaactctcaagaggggaag
gctctgtatcagtcatttatagtggactcgtgtaggaatatagttcatattctggaagac
ctgaagtcctgcaagccaccgctggaccacctctgtgaactgctgcctcgcctccaacct
agatattattcaatttcatcaagtcccaagttgtacccggagactgttcacgtgacggca
gtggtcgttaagtacgagactccgacgggaaggctgaataagggagtcaccaccacgtgg
ctggcggaaaacaaacccgaaccagggaagcccttccccagggtgcccatctacataagg
aagtcgcagttcaggctgcccctccagacccagacgccggtgctgatggtgggtccggga
acggggttggctcccttcagaggtttcctacaagagcgatcccacgctagaatcaatggc
aaagaagtcggtgacactatattatacttcggatgcaggcatcgcgaccaggattacatc
taccaagaggaactggaagagttcgagaggaacggagacgtcacgttacacgtggccttc
tcacgcgaccagcctaagaaggtctacgtgacgcatttgctggagaacaacttggaacag
atatgggacgtgatcggcaataggaacggacacttctatatttgcggcgacgctaagaac
atggcggtggacgtccgcaacattgtcatcaaggccgtccaagagaagggaggtcgctct
gaagccgaggcggtgcagttccttaagaaactggaatccatgaagaaatattcagccgac
gtgtggagttaa

DBGET integrated database retrieval system