KEGG   Danaus plexippus (monarch butterfly): KGM_206366Help
Entry
KGM_206366        CDS       T04344                                 

Definition
(GenBank) putative multiple inositol polyphosphate phosphatase 1 precursor
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00010  Glycolysis / Gluconeogenesis
dpl00562  Inositol phosphate metabolism
dpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KGM_206366
   00562 Inositol phosphate metabolism
    KGM_206366
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     KGM_206366
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     KGM_206366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: OWR52086
UniProt: A0A212FEA4
Position
Unknown
AA seq 380 aa AA seqDB search
MCICINLPLVYSQCYWNRTPYSYYGSKTPYDATRGDFRDVPPLKGCKLESIWFMARDGAR
HPDKEDKNDMKDILDLKDDILDNYEDGRGDLCAQDIADLRAWTWNDKLDRAVYHLTPEGY
RELLGFGERFSVMFQSLLENLDVSLIRSTKEQRTIKNARSFIEGLKNIKKPIVVDDPILD
DPVARLQANVQRRVGLDFELNPKSILSVYNLCRNYRSYSVLKRSPWCALFTDDELMILEY
VENITHYYRNGYGHSTNILLGALGLKDLYQKFEEASKGGLKTLTGYFTHETMLHMIYTAM
GLYMDYPEVSGLERVKHRKWRTSFLTPFAANFVAVLHRVQFLVNEKELHLCGDRSCSLEE
FRHKFQKFNNASYDFCNEDY
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtgtatctgtattaatctgccgttagtgtacagccagtgttactggaatagaacaccg
tatagttattatggtagcaagacaccatatgatgcaacaagaggagattttagagacgtt
cctccattgaaaggttgtaaacttgaaagcatatggttcatggcgcgggatggagctcgg
caccctgataaagaagataagaatgacatgaaggacattctagatctgaaggatgatatc
ttggacaattatgaagatggaagaggtgacttatgtgcacaggatattgcagatttgcgg
gcatggacctggaatgataaattggatagagctgtttaccacctaactccagaaggttac
agggaattactgggttttggtgaaaggttttcagtaatgtttcaatcattattggaaaac
ctggatgtatccctcataagatcgactaaagagcaaagaaccattaaaaatgcaagatct
tttatcgaaggtttgaaaaatatcaaaaaacctattgtagttgacgatcctattttggac
gaccctgtagcaagactccaagctaatgtacaaagacgagtaggtctcgattttgaattg
aatcctaaaagtattctcagtgtatacaatctctgtaggaattaccgatcatactctgtg
ctgaagagaagtccttggtgtgcgcttttcactgacgatgagcttatgatcttggaatat
gttgagaatatcacacattattacaggaatggctacgggcattccaccaacatacttctt
ggagctctgggtctgaaagatctttatcagaagtttgaagaggcgtcaaaggggggcttg
aaaacgttgacgggttactttactcatgaaactatgctgcatatgatttacacggccatg
ggactttatatggattacccagaagtatccggtctcgagagggttaaacatagaaagtgg
cggacgagtttcttgacaccattcgctgctaatttcgtcgccgttctacacagagtgcag
ttcttagtcaacgagaaagagctacatctttgcggggaccgctcctgttcccttgaggaa
ttcagacataagttccaaaaattcaacaacgcctcgtacgacttctgcaatgaggactat
taa

DBGET integrated database retrieval system