KEGG   Danaus plexippus (monarch butterfly): KGM_209775BHelp
Entry
KGM_209775B       CDS       T04344                                 

Definition
(GenBank) putative apyrase
  KO
K19970  5'-nucleotidase [EC:3.1.3.5]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00230  Purine metabolism
dpl00240  Pyrimidine metabolism
dpl00760  Nicotinate and nicotinamide metabolism
dpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KGM_209775B
   00240 Pyrimidine metabolism
    KGM_209775B
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KGM_209775B
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dpl04090]
    KGM_209775B
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dpl00537]
    KGM_209775B
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     KGM_209775B
CD molecules [BR:dpl04090]
 Proteins
  KGM_209775B
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dpl00537]
 Enzymes
  KGM_209775B
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid_C
Motif
Other DBs
NCBI-ProteinID: OWR43042
UniProt: A0A212ENH1
Position
Unknown
AA seq 143 aa AA seqDB search
QACFFSNLLHARRGLCSTVGSDRLMMMMMIKYSMIINCFVTGMRVIFDGARPVNNRVVNA
TIRCNYCDIPTYAPLDPNKYYKVVSQSFIGGGGDGFSMISNNRQNVEVLGVDYDILLRYV
RHQSPIMKDLDGRILIKDPCLEN
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
caagcgtgcttcttctctaaccttctccatgcgagaagaggcctgtgctcaacagtgggc
tctgataggctgatgatgatgatgatgattaaatattctatgataatcaattgttttgtg
acaggtatgcgagttatatttgatggagcccgtcccgttaacaatagagttgtaaatgct
acaataaggtgtaattattgtgatataccaacatacgcgcctctggatccgaacaaatat
tacaaagtcgtttcacaatccttcatcggaggtggtggcgatggatttagtatgatatcg
aataatcgccagaacgtagaagtgttgggtgtggattacgacatactgttacgttacgta
cggcatcagtcgccgatcatgaaggacttggacggacggatacttataaaagatccatgt
ttagagaactga

DBGET integrated database retrieval system