KEGG   Danaus plexippus (monarch butterfly): KGM_211026AHelp
Entry
KGM_211026A       CDS       T04344                                 

Definition
(GenBank) autophagy-related protein 16-1
  KO
K17890  autophagy-related protein 16-1
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl04136  Autophagy - other
dpl04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    KGM_211026A
   04136 Autophagy - other
    KGM_211026A
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpl04131]
    KGM_211026A
   03029 Mitochondrial biogenesis [BR:dpl03029]
    KGM_211026A
Membrane trafficking [BR:dpl04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    KGM_211026A
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    KGM_211026A
Mitochondrial biogenesis [BR:dpl03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    KGM_211026A
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 Cytochrom_D1 eIF2A
Motif
Other DBs
NCBI-ProteinID: OWR50336
UniProt: A0A212F9A4
Position
Unknown
AA seq 168 aa AA seqDB search
MAAKFLGEPTKVISGSHDRTLKIWDLRSRMCTETKFAGSSCNDLVTSDGAGSTIISGHFD
KRIRFWDIRTEMSANHIMLQGKVTSLDLSRDSNYLLACVRDDTIQLIDLRMNNIVRSFSH
ESFKVGCDWSRAAFGPGGRLLSVGAADGAAYVWNTHSGRLEAVLKDHT
NT seq 503 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaaatttctcggagaacctactaaagtaatttctggaagccatgatcgaacg
ttaaaaatatgggatcttcgaagtagaatgtgtacagaaaccaaattcgcaggatcatct
tgcaacgatctggtgacttcagacggcgcaggctctaccatcatctcaggacattttgac
aaacggatacgcttctgggacatacgcacagagatgtcggccaaccacatcatgctccag
ggcaaagtcacatcgctcgacctcagcagagatagcaactatttgttggcctgtgtccga
gatgatactatacagcttatagatttgcgaatgaacaacattgtacggtcttttagtcac
gagtcgtttaaggtgggttgcgactggtcgcgggcggcgttcgggccgggcgggcggttg
ttgtcagtgggcgcggctgatggagccgcttatgtatggaacacacactctggtagattg
gaggccgttctgaaggatcatac

DBGET integrated database retrieval system