KEGG   Danaus plexippus (monarch butterfly): KGM_211445Help
Entry
KGM_211445        CDS       T04344                                 

Definition
(GenBank) receptor guanylyl cyclase GC-II
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00230  Purine metabolism
dpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KGM_211445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpl01001]
    KGM_211445
Enzymes [BR:dpl01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     KGM_211445
Protein kinases [BR:dpl01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   KGM_211445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-ProteinID: OWR43587
UniProt: A0A212EQ47
Position
Unknown
AA seq 1137 aa AA seqDB search
MLQPLLLALATARPLDTDHTNDTQRLLIVARQACHADDPTLYSADLFSAHLTQYAPSQLR
TRPFRLLNYEETCGPRWSEAVLVDVLRSVGAGGSVVGAGRVGGRVCGGVSPALLSLGRPL
PGSCSESPARAAAVSLLARSLGWRRVSLLVTGVLDECSAALLRVQESLVTSGVLVKRALP
RHLEDSFSIRPHALIICGSAMTAAILSRNVNKIQILILNVIDPEVETSLKGNGTKTIDKQ
SANVTGKERSMYQKFHFGELSKDSLNVIREKPLLLLSDRQFEVQHLAKDNYDEIIKALLN
FREAEITRMEKYHHVFHLYSSITKENDLFWKQRATLNITTERLLDNYTSHSTLVNIDALK
ETELEEFKLEGAFDETVDAKVSSGTDAALHMTVFTLFVTCILILILTFVVTCLKRVFVNR
MPKRSRAVPVLASTDFQFPSDEGRRVGEGMETMLTWLQQLHEFGSSEPERPDLLKRPEPL
GQSAPSSTCSITRLPLDNRTRYKGDPVHMKYLPAASLELRRKSIDVLLTMQSLRHENVNS
FIGCLTETRPALVFEACGRGSLEDVLMADDIRLDWTFRLSLLTDLVRGMRYLHSSPLRVH
GRLTSRNCVVDSRWVLRVTDYGIPSFTKTQSLPHPPRTARELLWTAPELLREADSGNVIC
GTQPADVFSFAIIMQEVIVRGEPYCMLPFTPEEIIEKLTHPPPLIRPSVSMSAAPPEAVS
VARQCWSEQPHLRPDFIQLYEVFRHMHRGRKVNIVDSMFEMLEKYSNNLEELIKERTEQL
DMEKKKTEQLLNRMLPRTVAERLILGLRVEPEEFEEVSIYFSDIVGFTSIAARSTPVQVV
DLLNDLYTTFDATIEMYRVYKVETIGDAYMVVGGLPIRSSDHAESVATMALHLLHLAGQF
RIRHLPASPLHLRIGLHTGACCAGVVGLTMPRYCLFGDTVNTASRMESTGAAWRIQISSA
TAEKLAAAGGYRLRSRGLTQIKGKGVMHTFWLLGKEGFEKTLPTPPPLKSEEVLFEAESE
NDCDTNEAPPSEGHNTSLTQSVERQRSDPSPTVDRFSWRRSGAVSAESSPPGPTSLRNRY
LRSSVSTVAGLVDTPRLSDRWTTSGSRVLRRQWSLERGDEPRYRTRRDLSTPDASAR
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagcctctcctgctggcgctggccacagctcggcctctcgacaccgaccacacc
aacgacacacagcggctcttgatagtggcacgacaagcttgtcacgccgacgaccctacc
ctctactctgcggacctgttctccgctcatctcacacagtatgcgccgtctcagctccgg
actcgtcctttccgtcttcttaattacgaagagacctgcggccctcgctggtctgaggcg
gtcctggtggacgtgttgcggtcggtgggcgcgggcgggtccgtggtgggcgcgggtcgt
gtgggcggtcgtgtgtgtggtggcgtgtccccggccctgctgtctctcggacggcctctc
cctgggtcgtgctctgagtccccggctcgtgccgcggccgtctctctcttggctcggtct
ctgggctggcggcgcgtctctctgctcgtgaccggagtcctcgacgaatgctcagccgct
cttcttcgggtccaagagtctctcgttacgtccggtgtcctcgtgaaacgcgcacttcct
cgacacctcgaggactctttctcgatccgtccccacgctctcattatctgtggttcggcg
atgacggccgcgatactatcaagaaatgtgaataaaattcagatacttatcttaaatgta
atagatcctgaagtagagacctctttgaaaggtaatggaacgaaaactatcgacaagcaa
tcggctaatgttacaggcaaagagagatcaatgtatcagaagtttcatttcggcgagctt
tctaaagacagccttaatgttatcagagagaagccattactcctgctgagtgacaggcag
ttcgaagttcagcaccttgccaaggataattatgatgaaataattaaggcccttttaaac
ttcagggaagcggagattaccagaatggaaaaataccatcatgtttttcatttatatagt
agtataactaaggaaaacgatttgttctggaagcaaagagcaacacttaatattacaact
gagagattgttagataattatacgtcacactccacactcgtgaatatcgacgccctgaaa
gaaaccgaactcgaggaatttaaactagagggcgcatttgacgaaacggtcgacgcgaag
gtctccagcggtacggacgcagccttgcacatgacggtgttcacgttgttcgtcacctgt
atcttgatcctcatcctcaccttcgtcgtaacatgcctcaaacgggtgtttgtcaaccgt
atgccgaaacgttctcgtgcagttccggttcttgcttccaccgacttccagtttccatcg
gatgagggacgacgtgtgggcgagggcatggagacgatgctcacgtggcttcaacagctg
cacgaattcggaagctcggaaccggagcgacccgacttactgaaacggcccgaacccttg
gggcagtccgcaccctcctctacgtgcagcattacacgtcttccattggacaatcgtacc
agatataagggcgacccagttcatatgaaatatttacctgcggcttcactcgagttgcgt
cgcaaatcaatagacgttttactcacgatgcagagccttcgtcacgaaaacgtaaactcc
ttcataggatgtttgacggaaacaagaccagctctcgtgttcgaagcttgtgggagaggt
tctctagaagacgtcctcatggccgacgacatccggttggattggacgttccgcctgtcg
ctgctaacggacctggtgcgagggatgcgctacctccactcatcgccgctgcgtgttcat
ggtcgactcacttcacgtaactgtgtagtcgactcccgatgggtgttgcgtgtcaccgat
tatgggattccatcgttcacaaagacgcagtcactgccgcaccctccgcgtaccgcacga
gagctgctgtggacggcgccggagcttcttcgtgaagccgattcaggtaacgtcatctgc
ggaacgcagccggccgatgtgttctctttcgctataatcatgcaggaggttattgtccgt
ggagagccttactgtatgcttccttttacgccggaagaaataatagaaaagttgactcat
cccccgcctcttataagaccgtccgtgtccatgagcgctgctcccccggaggcagtgagt
gtggcacgtcagtgctggagcgaacagcctcatctacgaccagacttcatacaactctac
gaggtgttccgacacatgcatcgaggacgaaaagtcaacattgtagattctatgttcgaa
atgttagagaaatacagcaataatttagaggaattgataaaggaacgaaccgagcagctg
gacatggagaaaaagaaaacggagcagctcctgaacaggatgttgcccagaacagtagcc
gagcgattaattttgggtctccgagtggagccggaagagttcgaggaagtatccatctac
ttcagcgacatcgtgggtttcacatcaatagcagcgcgctccactcccgtccaggtcgtt
gacctgctcaatgacctgtataccaccttcgatgctactatagaaatgtaccgagtctac
aaggtggaaacgatcggtgacgcgtacatggtggtgggcgggctgccgatccgctccagc
gaccacgcagagagcgtggcgaccatggcgttacatttattacacttggcgggacaattt
cgaattcgacatctgccagcgtctcctctacatctccggatagggctccacacgggcgct
tgttgtgcgggagtggtgggactcactatgccacggtattgtttgtttggtgacacggtc
aacacggcttcccgcatggaatccacaggagcggcttggcgaatccagatctcgtcggcg
acggcagagaaactcgcagcggccggcggctacaggcttcgctcccgaggactcacgcag
attaaaggcaaaggcgtcatgcacaccttctggttactcggaaaagaaggctttgaaaaa
actctgccgacgccaccgccgttgaaatcggaagaagttctctttgaagcagagagcgag
aacgactgtgacactaacgaggcgccaccaagcgagggacataacactagcctcacacaa
tccgtggaacgacaacgttccgatccatctccgacagtcgacagattttcatggcgaagg
tctggtgcagtctccgcggagagcagcccgccaggaccgacctcattgcgaaatcgatac
ttacgttcatccgtgtccactgtggcaggcttagtcgatacaccgcgcctatcggatcgg
tggactacatcaggatcgcgcgtgctgcggcgtcagtggtcgctggagcgcggggacgag
cctcgttaccggacccggcgcgacctctccactcccgacgcgtccgctcgctga

DBGET integrated database retrieval system