KEGG   Danaus plexippus (monarch butterfly): KGM_211867Help
Entry
KGM_211867        CDS       T04344                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KGM_211867
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dpl01007]
    KGM_211867
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dpl03016]
    KGM_211867
Enzymes [BR:dpl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     KGM_211867
Amino acid related enzymes [BR:dpl01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   KGM_211867
Transfer RNA biogenesis [BR:dpl03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    KGM_211867
 Prokaryotic Type
    KGM_211867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DUF2383 tRNA-synt_1 tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: OWR53371
UniProt: A0A212FI10
Position
Unknown
AA seq 722 aa AA seqDB search
MAKRTQPPWSLPSGEEKRPVLNLYNSLTRQKEEFVCGHGNRVNWYSCGPTVYDASHMGHA
RSYISFDILRRVLTTYFGYDVLYAMNITDIDDKIIKRARQNYLYENYVKDTKTLDQIVDD
ATAVIDFYEGIVRDANDPDKKNTLQKMLDSVASAVKTLKSALQESKSDKIEEAKSDLLKS
AKDPISVWLDEKYGATVTENGIFQTLPRYWENEFHKDMKALNVLPPDVLTRVSEYIPQII
TFIQRIIDNGLAYESNGSVYFNVSEFDGKDKHYYARLVPEAYGDNKSLQEGEGDLTDSTA
EKRSLNDFALWKQSKTGEPSWESPWGRGRPGWHIECSAMASDVFGDNLDIHTGGVDLKFP
HHDNELAQSEAHFDKPGWVNYFLHTGHLTIAGCKMSKSLKNFITIKQALEQHSARQLRLA
FLMHGWRDTLDYSHNTMDMALQAEKLFNEFFLTVKDALRSLPECEGPWSEPERRLAGALT
AAREHVHQALCDNVDTRSALDALRELVSACHVYLGGVAEVPRSAPLLRASALYVTDILHV
FGVIEGPRGLIGFPAAGAGEVALEEAVLPYLEVLGSFRADVRGAARRAGAGEVLTLCDRL
RDELLPELGVRLEDKPDRTVVKLVNKDELIREREERKRQEEERQRKKRELADAQRAKDEQ
KKIPPEEMFRREAGKYSQFDEQGLPTHDHEGKELSKGLIKKLQKLQQLQEKKYKEHLASL
GN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaagaacacaaccaccttggtctttgccttccggtgaagaaaaaagaccagtt
ttaaatctttataatagtctgacccgacagaaagaggaatttgtttgtggtcatggcaat
cgagtgaactggtatagctgcggaccaactgtgtacgacgcctcgcacatgggacacgcg
aggtcatacatatcatttgatattctgaggcgagtgttgaccacttactttgggtatgat
gtgttgtatgcaatgaatataaccgacattgatgataagattataaagagagcgagacag
aactacctgtatgagaattatgtcaaagacacgaaaacattggaccagatcgtggacgat
gcaaccgcagtcatagacttctatgaaggtatcgtcagagacgccaatgatcccgataag
aagaacaccttgcagaagatgctggacagtgttgcttcagccgtaaaaactttaaaatca
gcacttcaagaaagtaaatctgataaaatcgaagaagcaaaaagtgatctcttaaaatca
gctaaagatcccatatcagtctggttggatgagaagtacggtgcgaccgtcacggaaaat
gggatatttcaaacactgccccgatattgggaaaatgagttccacaaagacatgaaagct
ctcaatgtcctgccccccgatgtgttgaccagagtcagtgagtacattccacagataata
accttcatccaaaggatcattgacaatggcctggcttacgagtccaacggttctgtgtat
ttcaatgtgagcgagtttgatggcaaagataagcattactacgccagactcgtccccgag
gcctacggggacaacaaatctttgcaagaaggggaaggtgacttaaccgatagcacagcc
gagaagcgctcactcaatgatttcgctctctggaagcagagcaagaccggcgagccgtcg
tgggagtccccgtggggtcgcggccggcccggctggcacatagagtgctccgccatggcc
tcggacgtgttcggagacaacctcgacatccacaccggcggagtggacctcaagttcccc
catcacgacaacgagctggctcagagcgaggctcacttcgacaagccgggctgggtgaac
tacttcctccacacgggccatctcacgatagccggctgtaagatgtccaagtccttgaag
aacttcatcaccataaagcaggctctggagcagcactcggcgcggcagctgcggctggcc
ttcctgatgcacggctggagggacaccctggactactcgcacaacaccatggacatggcg
ctccaggctgagaagctgttcaatgagttcttcctgacggtgaaggatgccctccgcagt
ctcccggagtgcgaggggccgtggagcgagcccgagcggcgcctggccggggcgctcacc
gcggccagggagcacgtgcaccaggcgctatgcgataatgtggacactcgttcagcgctg
gacgcgctccgtgagctggtgagcgcttgccacgtgtacctgggcggagtcgccgaggtt
ccccggagcgccccgctacttcgagcctccgccctctacgtcaccgatatactccacgtg
tttggagtcatcgagggcccccgtgggctcatagggttcccggcggctggggccggagaa
gtggctctggaggaggccgtgctgccgtacctggaggtgctgggttcgttccgggcggac
gtgcggggggcggcgcggcgggcgggggcgggggaggtgctgactctgtgtgaccgcctg
cgagacgagctgctgcccgagctgggcgtgcggctcgaggacaagcccgataggacggtg
gtgaagctggtcaacaaggacgagctgatccgggagagagaggagaggaagaggcaggag
gaagagaggcagaggaagaagagggagctggcggacgcccagagggccaaggacgagcag
aagaagataccgcccgaggagatgttccgcagagaagcggggaagtactcgcagtttgac
gaacagggcctgcccacgcacgaccacgagggcaaggagctgagcaagggtctcatcaag
aagctgcagaagttgcagcagctccaggagaagaagtacaaggaacacctggcgagcctc
gggaactga

DBGET integrated database retrieval system