KEGG   Danaus plexippus (monarch butterfly): KGM_212437AHelp
Entry
KGM_212437A       CDS       T04344                                 

Definition
(GenBank) ATP-dependent RNA helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    KGM_212437A
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dpl03041]
    KGM_212437A
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     KGM_212437A
Spliceosome [BR:dpl03041]
 Complex C
  Other components
   Step II factors
    KGM_212437A
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 Flavi_DEAD PhoH
Motif
Other DBs
NCBI-ProteinID: OWR51409
UniProt: A0A212FCD5
Position
Unknown
AA seq 967 aa AA seqDB search
MDEVSKLEHLSLVSKICTELDNHLGLNDKDLAEFIIDLADKNPNFDNFKKALIENGAEFS
DSFMTNLLRIIQHMKPSENQADGPQKEIKSSNPLASKFPGLAIPNDKPSKFSSDDESEDD
NKNTRITSKDIFKTESKAKESCVDVEDAMAALEALAPSNINKGKDESKKDIIKKRDQSGD
RSETIRKRERSRERKRSRSRERRRRSKDRDRRSRSRKRSRSRSRRSHSKERTNRSRDQRS
RDRDRRRRSRSKPRHRSRSRDRQRRSRSTNRRSRSRSRSYERKERNRYNDYGRNQKRRSA
EVEMTDDPEPGKIYNGRVANIVPFGCFVQMEGLRKRWEGLVHISQLRAEGRVTNVSDVVS
RGDKVKVLLSVTGQKVSLTMKDVCQESGKDLNPTSHAHLEVERSGRNPDRPPAVLAGLQL
DPDEDSSRKRVTRISSPERWEIKQMISSGVIDKSELPDFDEETGLLPKEEDGEADIEIEL
VEEEPPFLQGHGRALHDLSPVRIVKNPDGSLAQAAMMQSALAKERREQKMIQREQEMESL
PTGLNKNWIDPLPEADGRALAANMRGSGITPQDLPEWKKHVIGGKKSSFGKKTNLSLLEQ
RQSLPIYKLRDELTKAISDNQILIVIGETGSGKTTQITQYVCECGVSGRGRVACTQPRRV
AAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTGPDTVIKYMTDGMLLRECLMDLDLKSYSV
IMLDEAHERTIHTDVLFGLLKQAVQKRPELKLIVTSATLDAVKFSQYFFEAPIFTIPGRT
FPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLG
PDVPELIILPVYSALPSEMQTRIFEPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVK
QKVYNSKTGMDSLVVTPISQAAAKVARPARPATGPGKCYRLYTERAYRDEMLPTPVPEIQ
RTNLATT
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagtttcaaagctagaacatctttctctggtgtccaaaatatgcacagagttg
gacaaccatttgggattgaatgataaagatttagctgagttcattatcgacttggccgac
aagaacccaaactttgacaattttaaaaaagcacttatcgagaatggtgcggaattttct
gactcattcatgacaaacctgctacgtattattcaacatatgaaaccttctgaaaatcaa
gctgacgggccacagaaagagatcaagagcagtaatcctctggcaagcaaatttccaggt
ttggctattcccaatgataaacctagtaaattttcatcagatgatgaaagcgaagatgat
aataaaaatacgagaataacatcaaaggacatatttaaaactgaatctaaagcaaaggag
tcgtgtgtcgatgttgaggatgcgatggcagcgctagaggcgctagcaccgtccaatata
aacaaaggcaaggatgagtcaaagaaagatatcataaagaagagagaccagagcggcgat
cgtagcgaaactattaggaaacgagaaagatcgagggaaagaaagcgcagtagaagtagg
gagaggagacgccgcagtaaagatagagacagacgtagccgtagtcgtaagagaagtcgc
agtagaagcagaagaagtcacagcaaagaaagaacaaatagaagtagagatcagagaagt
agagacagggatagacgaagacgttccagaagtaaacctcgacatagatccaggtctaga
gataggcaacggagatccagatctactaatagaagatctagatccagatcccgttcatat
gaaagaaaagaaagaaatagatacaatgattatggcagaaatcagaaaagaagaagcgct
gaggtggagatgaccgatgatcctgaaccggggaaaatttacaatggacgagtggcaaac
atagtaccgtttggatgcttcgtacagatggaagggctgcggaagagatgggagggtctc
gtacacatctctcaactcagagctgaaggtagagtcacgaatgtatccgatgtagtgtcc
aggggtgacaaagttaaggtattactgtcagtgaccggacaaaaggtatcactgacgatg
aaggatgtctgtcaagagtccggcaaggatttaaatccgacttcacatgcacatctagag
gtggagcgttcaggtcgcaacccggaccgtcccccggccgtgttggcgggactccaacta
gaccctgatgaagactccagccgcaaacgggtcaccaggatatccagtcccgagcgatgg
gagatcaaacagatgatatcatcaggtgtgatcgataaaagcgagttgccagatttcgat
gaagaaacgggtcttctgcccaaagaggaggacggagaagcggacatcgagatagaactg
gtcgaggaggaaccgcccttcctacaaggtcacgggcgagctctacacgacctgtcccct
gttagaatagtcaagaatcctgatggatcactagcgcaggccgccatgatgcagtccgct
ctggcgaaggagagaagagaacagaagatgatacagagagaacaggagatggagagtctg
ccgaccggtctcaacaaaaactggatcgatcctctaccggaagcggacgggagggcgtta
gcggctaacatgcgaggctcgggcataacaccgcaggacttgcccgagtggaagaaacac
gtcatcggggggaagaaatcttcattcggcaagaaaactaacctgtccctcctggagcag
aggcagtccctgcccatttacaagttgagagacgaattgaccaaggccatatccgacaac
cagatcctgatagtgataggagagacgggttccgggaagacgactcaaatcacgcagtac
gtctgcgagtgtggcgtgtccgggcggggccgtgtggcgtgcacccagcccaggagagtg
gccgccatgtccgtcgccaagagggtcgctgaggagttcggctgcaggctgggtcaagag
gtcggctacaccatacgatttgaggactgcaccggacccgacacggtcatcaagtacatg
acagacggtatgttgctccgcgagtgtctgatggatctggacctgaagagctactccgtc
atcatgctggacgaggcccacgagcgcaccatacacacggacgtgctgttcggcctcctc
aaacaagcggtccagaaacgaccggaactcaaactgatcgtgacatccgccaccctggac
gccgtgaaattctcccagtacttcttcgaggcccccatcttcaccatacccggacggacc
ttccccgtcgaggttctgtacacaaaggaaccggaaacggattacctggacgcctcctta
ataaccgtcatgcaaatacatctgcgtgaaccgcccggggatattctgctgtttttgacc
ggccaggaggaaatcgacaccgcctgcgagatactgtacgagaggatgaagtccctcggc
ccggatgtacctgagctgatcattcttccggtttactccgcccttccgtctgagatgcag
accagaatcttcgaacccgctccgcctggctcgaggaaggtggtgatagctaccaacata
gcggagacctcgctcaccatagacggcatttactacgtagtggaccccgggttcgtcaaa
cagaaggtctacaattcaaagaccggtatggactcgttggtcgtcaccccgatctcacag
gcggcggcgaaagtcgctcggccagcacgcccagcgactggcccggggaagtgttaccga
ctgtacacggagcgcgcataccgggatgaaatgttgcccacccctgtcccggaaatacaa
aggactaatctcgccactaca

DBGET integrated database retrieval system