KEGG   Danaus plexippus (monarch butterfly): KGM_212635BHelp
Entry
KGM_212635B       CDS       T04344                                 

Definition
(GenBank) equilibrative nucleoside transporter 3 like protein
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
dpl  Danaus plexippus (monarch butterfly)
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dpl02000]
    KGM_212635B
Transporters [BR:dpl02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   KGM_212635B
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-ProteinID: OWR44078
UniProt: A0A212ERF3
Position
Unknown
AA seq 308 aa AA seqDB search
LKYFDCDLPPKQVALIAVSTELYKTNKHDFDLTASAIFIGSLVGIASKFSKEYMGAVMSG
QSLGGIIAAIAQIISLAFKISPLHSALIYFIMADIILVISAVSYVLMNKIDFFSYHILRG
SGVATNRHRDASMLIILKKIWVYAFSIFAVFGISICVYPAVTVLVESHPVTTGTDWNNIF
FVPVVNYLIFNCGDYSGRLASAFLLRPTNQWVIASLSVLRVVGVPLLMLCNAQPRQHLPV
LFPWDYQYITIMIVFAFTNGYLTNIIMINSTRVVEIHEREKASSVIATMLSVGLTAGAAV
GMLLVRLL
NT seq 929 nt NT seq  +upstreamnt  +downstreamnt
gtctcaaatatttcgactgcgacctgccacctaagcaggtagcgttgatcgcggtttcta
cagaactatacaaaacaaataaacatgacttcgatttaactgccagcgctatcttcatcg
gcagtctggtcggtatagccagcaagttctccaaggagtacatgggcgcggtgatgagcg
gccagtccctgggcggcatcatagctgccatagcgcagatcatatctctggctttcaaga
tatccccgctccacagcgcgctcatatacttcataatggcggatatcattctggtcatat
cggccgtgtcctacgtcctgatgaacaagatagacttcttctcataccacatcctccgag
ggtcgggcgtggcgaccaacaggcacagggacgcgtccatgctgatcatactgaagaaga
tatgggtgtacgcgttcagcatcttcgctgtcttcgggatatccatctgcgtgtacccgg
ctgtgacggttttggtggagtcgcatccggtgaccacgggcaccgactggaacaacatat
tcttcgtgccggtcgtcaactacctgatcttcaactgcggcgattactccggcaggctcg
cctcggcgttcctgttgcgaccaaccaaccagtgggtgatcgcgtccctgagcgtgctgc
gcgtggtcggcgtgccgctgctgatgctgtgcaacgcccagccgcggcagcacctgcccg
tgctcttcccctgggactaccagtacatcaccatcatgatagtgttcgccttcaccaacg
gctacctcaccaacatcatcatgatcaactccaccagagtcgtggaaatccacgagcgcg
agaaagcgtcgagcgtgatcgccaccatgttgagcgtgggtctgacggccggcgcggcgg
tcggcatgctgctggtgcggctgctgtga

DBGET integrated database retrieval system