KEGG   Danaus plexippus (monarch butterfly): KGM_212721Help
Entry
KGM_212721        CDS       T04344                                 

Definition
(GenBank) putative O-Glycosyl hydrolase family 30 protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00511  Other glycan degradation
dpl00600  Sphingolipid metabolism
dpl01100  Metabolic pathways
dpl04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    KGM_212721
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    KGM_212721
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    KGM_212721
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     KGM_212721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: OWR47794
UniProt: A0A212F248
Position
Unknown
AA seq 2048 aa AA seqDB search
MMWFLLVACVLQIHGISSQHLKSDDCCPCSPENSFSSSNVLNKDHVSGNCPCRDADSEPA
SSIFRPSFKTATNARQVDGKEEPKPLLNPEVGLASSVLETLREVSDQEYQDALARDVARS
ALRSMNTNAEAGETGDESKNVVKIILGPRHNTDMDTISEPSHNHETRCIHPSPGQENVFE
QYQEQPQRKLYKHFILSKPVVGLQKNIFDMDNSPSDIQESVVTVRPSVLDNIKMKTDLLK
SKLFLNNEGLTQRNEPKISFDKVFYKPVIKLPDFNLASPLEHFKKSKLFDSYKTPSPAVM
TKDNFLYKSVNINGNSDLISPQQQSQSRKLDGNEKLLPQFNSLASKEARKSIKSTDSFIS
DDFNTDNTILKPVLALRDDCDPSRTWLQIQTTTEKSECVEVNSLPSSVPEEKSTDILSTV
PSPSELIGDENNAMKDGDNKLSENCEPNLNSNPNPERDVVDEDNETDLRASADQTTDDMT
NELLINEDRDERKEEDSENECIVSENTKDKENSIGVEVLNDSMEENKENKELMDDSESAA
NTDRKMNAISSIPELKEGIRNNLNELRKANEKWQEKMKLNVHDTLNRINKKNNIAKSPNI
QSESLKDNDSQNASEILQEFDGDTEAHASNNCKTPAEDFDEFKDHPVTDNIKEKYNTEYV
GSEPQNLNEHIPKNVDETNECKIHEEKTSNLDTKLDSVNNEESEMEVQASESKQRNAKID
LDNLRYVKQDINDEANNLNNVGSSFLQANNFFDDVKSKLTNVFGKTNENIFSGFVSNAGN
VDRTDSRGFIKDRVIDFTKPLLNLDKSTDLFKNAPDDTETKRHSIKSFNSNLQPFKARVA
IPESLDITPSLTRAGNTKEMSQKLYNSQRILPKTYASRIYSQNSDEKSGGDERLFYKESD
IGSLNSESTILSPKTFKNTLQFPTSKNLLSSNLKGRPDGALKNIHDTLGSSLRSMPFNHD
DLLETMASKRNELNERLKSLNYDLNDRLSSLLPSFRVQPLTQNRITSKNRSDVRNKQALD
NLRNLPFTNNVSSRSKLNTLSRKSNADSVAFKPLKKSVNVRDRLADLKILRLRDEPSLKR
PTSAKSVFTSPVESKSSRTASRTMKPAFRTDSKIISLTPPTSPKTSLPRLKTVKSPEKQP
SALYNMEKRPIISKLKSGEPFTLASENTMSRAPFHRTAVADKSALDTSSSDLDARSLHKT
SKQDVGKNIAISKLKEVLKARSFNNDLQKPKVIDDVIPAATEVGDPKTGILRQNVQYKLL
DRPCAVRTTPRESVVCVCNATYCDEIRREIPTKDNVIIYTSSKSGFRFTKSYGKLQALDS
LHSSRFLEIDPTTKYQTIEGFGGAVTDAASMNWKSVSDNLQDKLINSYFSEDGLQYNMLR
VPIGGSDFSTHAYAYNDLPENDAFLTNFTLAPEDIMYKIPMIKRIMAVSRTAVHIVATTW
SPPPWMKTGRSFAGFSRLKQEYFQTYADYHLKFLQKYNESGIPIWGLTTTNEPINGVFDL
CNFNSLGWTVTKMADWIVNNFGPTIRNSSFKDVKIMVGDDQRFTIPYWFIGMVAYRPESL
KYVDGVAVHYYTDQFISPIAFEAVTKAHPEKFVLSTEACEGTLPWQKNKVLLGSWQRAKT
YVLDILESGLRFHKSYGKWINTDSHYPTLEIDPTVKYQTIEGFGGSVTDAAAINWRSLSE
KSQRKLIKSYFSKNGLEYNMVRTPIGASDFSTHAYAYNDLPENDTLLTNFTLTPEDIMYK
IPMIKAIMKLSNTPVHIMAATWSPPMWMKTRYSFGGINRLKRSYYQTYADYHLKFLQRYK
EAGVPIWALTTTNEPINGVFNLIGFNCLGWDINDMGDWIVNYFGPTIRNSEFKDIKIIGG
DDQRFTIPYWIDMMQHTHPKALEYVDGIGVHFYTDEIIPANVFEPVSRQYPDKFIISTEA
CEGSQHRQRNKVLLGSWHRAKSYITDIIEDLNYNLVGWIDWNLCLDPRGGPNWASNFADA
AIIVDKTNDEFIKQPMFYAMGHFSKFIPRGSRRIKTVENESTSKLPLNHVAFITPRETIV
IVLHNDVD
NT seq 6147 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggttccttttggtagcgtgtgtgttgcagattcatggcatatcctcacagcat
ttaaaatctgacgattgctgtccttgctctccagaaaatagtttctccagtagtaacgtt
ttgaacaaagatcatgtctctgggaattgtccttgtagagatgcggattctgaacccgct
tcatctatatttagaccaagttttaaaacagctaccaatgccaggcaagtcgatggaaag
gaggagccaaagccacttttaaatccggaagtcggcctcgcgtcttcagttttagaaact
ttacgtgaagtttctgaccaagaataccaagatgctctggcaagagatgttgcgaggagt
gctttaagatcaatgaacacaaatgccgaggcaggtgaaactggcgatgaaagcaaaaat
gttgttaagattatattaggtcctagacataacacagatatggacaccatatctgaaccg
tctcacaaccacgaaacccgctgcatacacccatcgccaggacaagaaaacgtatttgaa
caataccaagaacagccacaaagaaaattatataagcacttcatcctgagtaagccagtt
gtaggtttacaaaaaaatatttttgacatggacaatagccccagcgacattcaagaaagc
gtagtgacagttagacccagtgtattagataatataaaaatgaagacagatctattgaaa
tcaaagttatttttaaacaatgagggattaacacaaagaaacgaacctaaaatatctttt
gataaggtattttataagccagtcataaaattgcccgacttcaatttggcttctcccttg
gagcattttaagaaatcaaagttatttgattcatacaagaccccctcacctgccgtgatg
acaaaagacaattttttatataaaagcgtcaacataaatggcaacagtgatcttatatca
ccgcagcaacaatcgcaaagtagaaaattggatggcaatgaaaaattattaccacaattt
aattcacttgcatccaaagaagctcgcaaatctataaaaagtacggattcttttattagt
gatgattttaatacggataatacaatattgaaaccagtattagcattgcgtgatgactgt
gatccatcacgaacctggttacagatacaaactactactgaaaaaagtgaatgtgttgag
gtcaatagtttgccatcaagtgttccagaggaaaaaagtacagatattttatcaacagtt
ccaagcccttcggaattaattggagatgaaaacaacgctatgaaagatggtgacaataaa
cttagtgaaaattgtgaaccaaatttaaacagtaatccaaatccagaacgcgacgttgtc
gatgaagataatgaaactgatttaagagctagtgctgatcaaacgactgatgacatgacg
aacgagctactaattaatgaggacagagacgaaagaaaagaagaggattccgaaaatgaa
tgcatcgtatcagaaaacactaaggataaggaaaattctattggtgtggaagttttaaat
gactcgatggaggaaaataaagaaaataaggaattgatggatgattctgaatccgctgct
aatacagataggaaaatgaacgcgatatctagtatcccagagttaaaagaaggcataaga
aataatctaaatgaattaagaaaagcaaacgagaagtggcaagaaaagatgaaacttaat
gttcatgatactttgaaccgaattaataaaaaaaataatattgctaaatctccaaatatt
cagtcagaatccctgaaggataatgattcacaaaatgcatctgaaatattgcaggaattc
gacggcgacactgaagcacacgcttcaaataattgtaaaacacctgctgaagattttgat
gaatttaaggatcatccagtaactgataatataaaagaaaaatataataccgaatatgta
ggaagtgaaccacaaaatttaaacgaacatattcctaaaaatgttgatgaaactaatgaa
tgtaaaattcacgaagaaaagactagcaatctagatacaaaattagactcagtaaacaac
gaagaaagcgaaatggaagttcaggcgagtgaatcaaagcaaaggaatgctaaaatagat
ctagataatttaaggtatgtgaaacaagacattaatgacgaagccaataatttaaataat
gttggaagttcgtttttacaagctaataacttttttgatgacgtcaagtcaaaacttact
aatgtgtttgggaaaacaaacgaaaatatatttagtggatttgtatccaacgcaggaaac
gtggatagaactgattcaagaggatttataaaagatcgtgttatagacttcactaaacct
cttctgaatttagataaaagtaccgatttatttaagaatgcaccggatgatacagaaacg
aaaagacatagtattaagtcatttaattcgaatctacaacctttcaaagcaagagttgca
atcccagagtcccttgatataacaccaagtttaacacgagctggaaatacaaaagaaatg
agccaaaaattgtataattcacaaagaatacttccgaaaacatacgcttctcggatatat
tcgcaaaattcggatgaaaagtcgggaggagatgaacgactattttacaaagaatcagac
atcggtagccttaattcagaatcaacaattttatcacctaagacatttaaaaatacctta
caattcccgacatccaaaaatcttttgtcgagtaacttaaaaggccgacctgatggagct
ttaaagaatatacatgacacgttggggagttctctgagatcaatgccattcaatcatgat
gacttacttgaaacgatggccagtaaaagaaacgaactcaacgaaagactcaaatcttta
aactatgatttaaacgatagactgtcctcgcttttgccctcatttagagtccaaccctta
acgcagaacagaataacttccaaaaacaggtccgatgttagaaataaacaagctttggat
aatttaagaaatttaccgttcaccaataacgtctcatcaagatctaaactgaatacatta
tcaagaaaaagtaatgctgattcggtcgcatttaaacctttaaaaaaatcagttaatgtg
agagatcgcctcgccgacctcaaaatactcagactacgtgatgaaccaagtttaaaaagg
cccacatctgctaagtctgtatttacatcaccagtggaatctaaatcttcacgcactgcg
agcagaactatgaaacctgcatttcgtacggatagcaaaattatttccttgactccacct
acttctcccaaaacgtcgcttccaaggttaaaaactgttaaatctcctgaaaaacaacct
tctgctctatataatatggagaaaagaccaattatttcaaaacttaagtctggtgaacca
tttaccttggctagcgaaaatacaatgtccagagcaccctttcaccgtacggcagttgca
gacaaatcagccttagatacttcatcaagtgacttggatgcacgatctcttcacaaaaca
tcgaaacaagacgtgggaaaaaatatagccatttcaaaattgaaagaagtattaaaagcg
agaagttttaataacgatttacaaaaaccaaaagttattgatgacgtcatcccagcagca
actgaagttggggatccgaagacaggaatcttgagacaaaatgtacagtataaattgtta
gacagaccgtgtgccgtcagaactactcctagggagtctgtggtctgtgtgtgcaacgca
acttactgtgatgagatccggagagagattcccaccaaagacaacgtcatcatatacaca
tcctcaaagagtggcttccgctttacaaaatcttatggaaaattgcaagctctagattca
ctacattcatcgagatttctggaaatcgatccgacgacaaaatatcagacgatcgagggt
ttcggtggagccgtcacggatgccgcttcaatgaactggaaaagtgtgtccgataattta
caggacaagctcataaattcttacttcagtgaagacggcctccaatataacatgcttcga
gtaccaatcggaggatcagatttctccacccacgcgtatgcttacaacgacttaccagag
aacgacgcctttcttactaacttcactctcgctcccgaagacatcatgtataaaattcca
atgatcaaaagaattatggcagtatcccgaacagcagtgcacatcgtggccacgacctgg
tctccgccgccttggatgaagacaggacgcagtttcgctggctttagcagattaaaacag
gaatattttcagacctacgctgattatcacttgaaatttcttcaaaagtacaatgaatct
gggataccgatctggggtctcacaaccaccaacgaacccatcaatggagtatttgattta
tgcaacttcaactctctcggctggaccgtcactaaaatggcagattggatcgtcaataac
tttggtccaacaatccggaactcctcttttaaagatgttaaaataatggttggagacgat
cagcggttcaccattccttattggtttatcgggatggtggcatatcgtcctgaatctctg
aagtacgtggacggtgtcgctgtacactactatacagaccagtttatttccccgattgcg
tttgaagctgtgactaaggctcatccagagaaatttgttctttccaccgaagcctgtgaa
ggcactttaccctggcagaaaaataaggtcctgttgggatcatggcaacgtgcgaagaca
tatgttttagatatattggagagtggtctacggtttcataaatcttatggaaagtggata
aacactgattcacattatccaacactggaaattgacccaacagtaaaatatcagacaatc
gagggttttgggggatcggtgacagacgctgctgctatcaactggaggagcttatcagaa
aagtcgcaaagaaaacttataaaatcgtatttcagtaaaaatggtttggaatacaatatg
gttcggacgcctataggagcgtcagacttctcaacccacgcgtacgcttacaacgactta
cccgagaatgacactcttctcactaatttcaccctcactcctgaagacattatgtacaaa
attccaatgataaaagctataatgaagttgtccaatacacctgtgcatatcatggctgcg
acctggtctccgccgatgtggatgaagacgcgctacagcttcggtggtataaatcgatta
aaaagaagctattaccaaacatacgctgattatcatttaaaatttctccagaggtataag
gaagcaggtgttccgatatgggctctcacaactaccaacgaacccatcaacggtgtcttc
aatcttataggattcaattgtctcggctgggatattaacgatatgggagactggattgta
aattatttcggaccgaccatccgtaattcggaattcaaagatatcaaaataatcggtggg
gacgaccagaggttcacgataccttactggattgacatgatgcagcacactcatcctaag
gctttggaatacgttgacggaatcggagtacacttctatactgatgagattataccagcc
aacgtcttcgaaccggtctctcgtcaatatccagataaatttattatatcaactgaggct
tgcgaagggagtcagcatagacaaagaaacaaagtgttattaggttcctggcatcgagcc
aagtcatacataacagatattatagaagatttaaattataacttagttggctggattgat
tggaatctgtgtctcgaccctcgcggaggtcccaactgggcgagtaacttcgctgatgct
gctataattgttgacaaaacaaacgacgaattcataaaacagcccatgttctatgcgatg
ggacatttttcaaagtttattcctcgtggttccagaagaataaaaactgttgaaaacgaa
tcaacgtctaaattgcctttaaaccatgttgccttcattacaccgagagaaacaatcgtt
attgtacttcataacgatgtagactaa

DBGET integrated database retrieval system