KEGG   Danaus plexippus (monarch butterfly): KGM_213168Help
Entry
KGM_213168        CDS       T04344                                 

Definition
(GenBank) hypothetical protein
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl04013  MAPK signaling pathway - fly
dpl04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    KGM_213168
   04350 TGF-beta signaling pathway
    KGM_213168
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpl01001]
    KGM_213168
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dpl04090]
    KGM_213168
Enzymes [BR:dpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     KGM_213168
Protein kinases [BR:dpl01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   KGM_213168
Cytokine receptors [BR:dpl04050]
 TGF-beta receptors
  Type I TGF-beta receptor
   KGM_213168
CD molecules [BR:dpl04090]
 Proteins
  KGM_213168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta_GS MHYT Activin_recp RskA DUF3995 DUF4381
Motif
Other DBs
NCBI-ProteinID: OWR50090
UniProt: A0A212F8N5
Position
Unknown
AA seq 164 aa AA seqDB search
MQCKSSQVPHQHPKVIECCEKDLCNRRLRPVLPGGSEGSPPALPAPPSSPAPPALVAAAL
CVALLAALAALWVLLRRRRSGKRPPSPPVIADHPEISSGSGSGLPLLVQRTVAKQIQMVE
SIGKGRYGEVWLARWRGRRSPSRFSSPPRRLAGSGRRRSTRRCS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgtaaaagttcccaagtgccacaccaacaccccaaagtgatagaatgttgtgag
aaggacctctgtaaccgtcgcctccgccctgtgttgcccggtgggtcggagggctctccg
cccgcccttcccgcgccgccatccagccccgccccgccggcgctcgtggccgccgccctg
tgcgtggctctcctagccgccttggcagccttgtgggtgctgctgcggaggaggcgctcc
ggcaagaggccgccctcgccgcccgtcatcgccgatcatcccgagatctcgtccggctcg
ggctccggcctgccgctcctcgtgcagcggacggtcgccaagcagatacagatggtggag
tccatagggaagggacgctacggagaggtgtggctcgcgcgctggcgggggagaaggtcg
ccgtcaaggttttcttcaccaccgaggaggctagctggttccgggagacggagatctacc
agacggtgctcatga

DBGET integrated database retrieval system