KEGG   Danaus plexippus (monarch butterfly): KGM_213925Help
Entry
KGM_213925        CDS       T04344                                 

Definition
(GenBank) heat shock protein 70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl03040  Spliceosome
dpl04141  Protein processing in endoplasmic reticulum
dpl04144  Endocytosis
dpl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    KGM_213925
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    KGM_213925
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    KGM_213925
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    KGM_213925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpl01009]
    KGM_213925
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dpl03041]
    KGM_213925
   03009 Ribosome biogenesis [BR:dpl03009]
    KGM_213925
   03110 Chaperones and folding catalysts [BR:dpl03110]
    KGM_213925
   04131 Membrane trafficking [BR:dpl04131]
    KGM_213925
   03051 Proteasome [BR:dpl03051]
    KGM_213925
   03029 Mitochondrial biogenesis [BR:dpl03029]
    KGM_213925
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpl04147]
    KGM_213925
Protein phosphatases and associated proteins [BR:dpl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     KGM_213925
Spliceosome [BR:dpl03041]
 Complex B
  Other components
   Prp19 complex
    KGM_213925
 Complex C
   Prp19-CDC5 complex
    KGM_213925
Ribosome biogenesis [BR:dpl03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    KGM_213925
Chaperones and folding catalysts [BR:dpl03110]
 Heat shock proteins
  HSP70 / DNAK
   KGM_213925
Membrane trafficking [BR:dpl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    KGM_213925
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    KGM_213925
Proteasome [BR:dpl03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    KGM_213925
Mitochondrial biogenesis [BR:dpl03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    KGM_213925
Exosome [BR:dpl04147]
 Exosomal proteins
  Proteins found in most exosomes
   KGM_213925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA Hydantoinase_A DUF3153
Motif
Other DBs
NCBI-ProteinID: OWR50325
UniProt: A0A212F995
Position
Unknown
AA seq 630 aa AA seqDB search
MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP
NNTVFDAKRLIGRKFDDPKIQADMKHWPFKVVNDCSKPKIQVEFKGETKRFAPEEISSMV
LVKMKETAEAYLGTTVRDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAY
GLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHFA
EEFVRKYKKDLRANPRALRRLRTAAERAKRTLSSSSEATIEIDALYEGIDFYTRVSRARF
EELNSDLFRGTLEPVEKALKDAKMDKSQIHDVVLVGGSTRIPKVQSLLQNFFCGKKLNLS
INPDEAVAYGAAVQAAILSGESDSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNCKIPC
KQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDA
NGILNVSAKENSTGRSKNIVIKNDKGRLSQSEIERMLAEAERYKEEDERQRQRVAARNQL
ESYVFSVKQALEDAGEKLSDGDKSAARNECDEAVRWLDNNTLAEKEEYEHRLKDLQRVCS
PIMSKLHGAGAATGPAGAARGSGPTVEEVD
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctattggtattgatctcggtacaacttactcctgcgttggtgtttggcaacat
ggaaatgtcgaaatcatcgcaaacgaccaaggcaacaggacgactccgtcttacgtcgca
ttcacagatacggagagattgatcggcgacgctgctaagaaccaggtggccctgaacccc
aacaacacagtcttcgacgcgaaacggttaatcggccgcaaattcgatgatcctaagata
caagccgacatgaagcactggcccttcaaagtggtcaacgactgtagcaaaccgaaaatc
caagtggagttcaagggcgagacgaagagattcgcccccgaggaaatcagcagcatggtg
ttggtcaagatgaaggagaccgcggaggcgtatctcggtacaacggttcgcgacgctgta
gtcacagttccggcttacttcaacgactcccagcgtcaagcgacgaaggatgccggagcg
atcgcaggtctgaacgttctccgcatcatcaacgagcccacagccgccgcactcgcctac
ggcctggacaagaacctcaaaggcgaacggaacgtgttgatcttcgatctcggcggcggc
accttcgacgtgtccattctgaccatcgacgagggctcgctgttcgaggtgaaggctacc
gctggagacacgcatctcggaggcgaggactttgacaacaggctggtgaatcatttcgct
gaagaattcgtcagaaagtacaagaaagaccttcgagccaaccctcgcgcgttgcgacgc
ctccgcaccgccgccgagcgcgccaagaggacgctgtcgtccagcagcgaagcgacgatc
gaaatagacgctctgtacgaggggatcgacttctacacccgggtctcccgcgccaggttc
gaggaactcaactccgacctgttccgcggtaccctggagccggtcgagaaggctctgaaa
gatgcgaagatggacaagagtcagatacacgacgtggtgctcgtcggtggatcgactcgc
atcccaaaggtgcagagcctgctgcagaacttcttctgcggcaagaagctcaacctgtcc
atcaatccggacgaagcggtggcctacggcgcggcggtccaggcggccatcctgagcgga
gagagcgactcgaagatccaggacgtgttgctcgtggacgtggctccgctgtctttgggc
atcgagaccgccggaggggtgatgacgaagatcatagaacgcaactgcaagatcccctgc
aagcagtcgcagacgttcaccacgtactcggacaaccagccggccgtcaccatccaggtg
tacgagggcgagcgagcgatgacgaaagacaacaacctgctggggacgttcgacctgacc
ggcataccgccggcgccgcgcggagtgcccaagatagacgtgaccttcgacctggacgcc
aacggcatcctgaacgtgtcggccaaggagaacagcacgggccgcagcaagaacatcgtg
atcaagaacgacaaggggcggctgtcgcaaagcgagatcgagcgcatgttggcggaggcg
gagcgctacaaggaagaggacgagcggcagagacagagggtggcggcaaggaaccagctg
gagtcgtacgtgttcagtgtgaagcaggccttggaggacgccggagagaagctgagcgac
ggagacaagagcgcggcgaggaacgagtgtgacgaggcggtgaggtggctggacaacaac
acgctggccgagaaggaggagtacgagcaccggctgaaggacctgcagagagtatgttcg
cccatcatgagcaagctacacggcgcgggggcggcgaccgggccagccggggcggcgcgg
ggcagcggacccacggtggaggaagtggactag

DBGET integrated database retrieval system