KEGG   Danaus plexippus (monarch butterfly): KGM_214009Help
Entry
KGM_214009        CDS       T04344                                 

Definition
(GenBank) cathepsin O like protein
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    KGM_214009
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dpl01002]
    KGM_214009
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     KGM_214009
Peptidases [BR:dpl01002]
 Cysteine Peptidases
  Family C1: papain family
   KGM_214009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-ProteinID: OWR43445
UniProt: A0A212EPL3
Position
Unknown
AA seq 382 aa AA seqDB search
MKKWWNWILVVALVCLLFVAIPLSYPDRTKESLRPMFDEYIENFNKTYKDDPAEYEKRLE
HFVASVKEIDRLNSAARGPEQHRARYGLTQMSDMSKDEFRDVHLSDEQPHRYRRHKLGKS
WSKGRVKDIEDVADNMDDYDDEDDDDKEGSPHHNIYIVIRKKRAMLPLQVDWRTKGVIGP
VRDQGLCGACWAFSTIGTMEAMAAIDTGKLNTLSVQEVIDCAGLGNSGCAGGDICLLLDW
LLMTDTAVQVEKEYPLKLTNGVCQAKKNATGVKVAKFTCTDLVGAEDKIIESIATHGPVA
VAVNALTWQNYLGGVIQYHCSGSPKELNHAVELVGYDLTAEVPYYIAKNSWGQGFGLDGY
LKLAIGCNICGLANEVASIDIK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatggtggaattggattcttgttgtggccttagtgtgtttgttattcgttgct
atacctctttcatatcccgataggactaaagaatcccttcgtcccatgtttgatgagtat
atagaaaatttcaataaaacttataaggacgaccccgccgagtacgaaaaaagattagag
cattttgtggcctccgtaaaagagatagatagattgaactcagcagcaagaggtcccgaa
cagcacagggcgaggtatggactcacacaaatgtcagatatgtcgaaagatgaattcaga
gatgtacatctatcagacgaacaacctcatcgatatagaagacataagctagggaagagt
tggagcaaaggtagagtgaaggatattgaggacgtggccgataacatggatgattacgat
gatgaggatgatgatgataaggagggtagtccgcatcataatatttatattgtcatcaga
aagaaacgcgccatgctaccacttcaggttgattggagaactaagggtgtgataggtccc
gtacgcgatcagggtctgtgtggagcgtgctgggctttcagtacgattggcacaatggaa
gccatggctgccatagacaccggcaagcttaacacgctcagtgtccaggaagttatagac
tgcgctggtttggggaacagcggttgtgctggtggcgatatatgccttttattagactgg
ttgctcatgacggataccgctgtccaagttgagaaggagtatcctctcaagctgacgaac
ggtgtatgtcaggctaagaaaaatgcaaccggtgtcaaagtcgccaagttcacgtgtacc
gatctggtgggcgcggaggataagataatcgagtctatagcaacccatggtccagtggcc
gtcgcggtgaacgcgctcacgtggcagaactaccttggcggtgtcatacagtaccattgc
agcggtagccccaaagaactgaaccacgctgtagagctagtaggttatgatctaacagca
gaggtaccttactacatagccaagaactcgtggggccaaggttttggtctcgacggatat
cttaaactggcgatcggatgcaacatatgcggactagccaatgaggtagctagcatagac
attaaatag

DBGET integrated database retrieval system