KEGG   Danaus plexippus (monarch butterfly): KGM_214402Help
Entry
KGM_214402        CDS       T04344                                 

Definition
(GenBank) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00500  Starch and sucrose metabolism
dpl01100  Metabolic pathways
Module
dpl_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KGM_214402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dpl01003]
    KGM_214402
Enzymes [BR:dpl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     KGM_214402
Glycosyltransferases [BR:dpl01003]
 Polysaccharide
  Storage polysaccharide
   KGM_214402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: OWR45581
UniProt: A0A212EVT8
Position
Unknown
AA seq 753 aa AA seqDB search
MSRDRSSRRFYRAESTHDLLSYMDKGQAACEENRWTFETAWEAANKVGGIYTVIRSKAYV
STEEMGDNYCLLGPYKETSARTEVEESDFPPNSPLTVAVNAMRSQGYKLHTGTWLVDGNP
QIILFDIGSAAWQMDSFKQELWDTTSVGIPHLDVEANDAVILGFMVAQFITEFRKAAENY
SDTPPRVVAHFHEWQAGIGLIVLRIRHVDVATVFTTHATLLGRYLCAGSTDFYNNLDKFS
VDEEAGKRQIYHRYCMERAAAHMTHVFTTVSDITGYEAEHLLKRKPDFITPNGLNVKKFS
ALHEFQNLHALAKNKINEFARGHFYGHFNFDLDKTLYFFIAGRYEFGNKGADIFIEALAR
LNHYLKSSGSDMTVIAFLIFPAKTNNFNVESLRGHAVTKALRDTISDIQQEIGRRMYDIC
LRGHLPEPSDLLHKDDTVRLKRCIYALQRDGLPPVTTHNVVDDWNDPVLNSVRRCQLFNT
VNDKVKVIFHPEFLTSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSIT
TNLSGFGCFMQEHIADPMSYGIYVVDRRYISLEGSVQQLAQYMFDFTKLTRRQRIIQRNR
TERLSDLMDWRNLGIYYRQARAQALKTVYPDYIDHMDRELGKRFNYPRPISEPPSPTHSM
RRNHETSWLTASYHKEIEQYKDYKDQAVQTDDLRRKSLEILGLSDPGGQDLEVTFERNLD
LSESDSFQTPTELLDVTEADQIEIMISDMNADT
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgggacagatcatcacgtcgattttaccgcgctgagtcgacccatgaccttttg
tcgtacatggacaagggtcaggctgcttgcgaggagaatagatggacattcgagacagcc
tgggaggctgccaataaagttggtggcatctacactgtcataagatcaaaggcgtatgta
tcaactgaggaaatgggagataactactgtttattaggtccttataaggagaccagtgcc
agaaccgaagtggaggaatcagactttccccccaactctcctcttactgtagcagtgaat
gccatgagaagtcaaggatataagcttcacacaggaacttggctggtggacggaaaccct
cagatcatcctcttcgacatcggttcagctgcgtggcagatggattccttcaagcaggag
ctatgggatacgacatctgtcgggataccgcacctagacgtggaggccaacgacgccgtt
attttgggcttcatggtggctcaatttatcacagagttcagaaaagcagccgagaactac
agcgacactccgccgcgagtggtcgcacatttccacgagtggcaggctggtataggactt
atagttttgagaatccgtcacgtcgatgtggcgacagtgttcacaacacacgcgaccctc
ctcggccgatacctgtgtgctggcagcacggatttctataataatttagataagttctct
gtggacgaggaggctggaaagagacagatatatcacaggtactgtatggagcgagcggcc
gctcacatgacgcacgtgtttacaaccgtctcggatataacaggctacgaggcggaacac
ctcctcaagaggaaacctgacttcattacgccgaacggcctcaacgtgaagaagttctcg
gcgcttcacgagtttcaaaatctccacgcgcttgccaagaacaaaattaacgagttcgct
agggggcatttctacggtcatttcaacttcgacttggacaagaccctatatttcttcatc
gctggacgatatgaattcggtaataagggagctgatatattcatagaggctttggccagg
ttgaatcactacttaaagtcttcaggatcagatatgacggtgatagcgttcctcatcttc
ccggccaagaccaacaacttcaacgtggagagtctccgaggacacgccgtcaccaaggcg
ctccgggacaccatcagcgacatacagcaggaaatcggccggaggatgtacgacatttgt
ctacgcggccacctcccggaaccgtcggacctacttcacaaggacgacacggttcgtctc
aagagatgtatctacgccctccagcgagacggtctcccgcctgttaccacgcataatgtt
gtggatgattggaatgaccccgtattaaattctgtccgccgctgtcaactgttcaacact
gtcaatgataaagttaaggtgatcttccacccggagttcctgacgtccactaacccgttg
ttcggtttagactacgaggagttcgtccgtgggtgtcatttgggggtgttcccttcgtac
tacgagccctgggggtatacaccagctgagtgtactgtcatggggataccgagcatcacc
actaatttatctgggttcggctgtttcatgcaggaacacatcgccgaccccatgtcctac
ggcatctacgtggtggacaggcggtacatatctctcgagggttccgtacaacaacttgct
caatacatgttcgactttaccaaactgacgagaagacagcgcattatacagaggaataga
acggaaagattgtcagatctcatggattggagaaatttaggcatttattaccgccaagcc
agggcccaggcgctgaagaccgtgtaccctgattacatcgatcacatggacagggaattg
ggcaaaaggttcaactaccctcgaccgatatcagaaccacccagtccgacacattctatg
cgtcgcaaccacgagacttcttggttgactgcgtcatatcacaaggaaatagaacaatat
aaggactataaagatcaggctgttcaaactgatgatttgaggaggaagtccttggagata
ttagggctatccgaccccgggggtcaagacctggaggtcacattcgagaggaacctggac
ctgtcagagtctgacagtttccagacgcccacagagctgctagatgtgaccgaagccgac
cagatagaaatcatgatcagcgatatgaacgcggatacctag

DBGET integrated database retrieval system