KEGG   Danaus plexippus (monarch butterfly): KGM_215802Help
Entry
KGM_215802        CDS       T04344                                 

Definition
(GenBank) mitochondrial ribosomal protein L53
  KO
K17434  large subunit ribosomal protein L53
Organism
dpl  Danaus plexippus (monarch butterfly)
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dpl03011]
    KGM_215802
Ribosome [BR:dpl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    KGM_215802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-ProteinID: OWR47742
UniProt: A0A212F1Y5
Position
Unknown
AA seq 144 aa AA seqDB search
MSIPYSGTIRRSGGVVSAIGKQLRAVNLKPAKRITVKFDPFGDNVTHTRHFVHYMSSPKV
ALTNPNCILKTEIVCDRSEPTVDINLVPSIAETANIQKVTFKSGNLTCLELLQLLNKHIS
ALAPKEQIPNTIQTKLEKKKGKKK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcccgtatagtggtactataagaaggtcaggcggagtggtttctgccatagga
aaacagttacgagcagttaatctgaaacctgcaaaacgtattacagttaaatttgatcca
tttggagataatgtcacacacacaaggcactttgtacattatatgagttcaccgaaagta
gctctaacaaatccaaattgcatcttgaaaacagaaattgtttgtgaccgtagtgagcca
acagttgacattaatttggtgccttcaatagcagaaactgctaacatacaaaaagttaca
ttcaaaagtggtaatttgacttgcctagaactactccagttattaaataaacacatatct
gctttggcacccaaagaacaaataccaaatacgatacaaacaaagttagaaaagaaaaag
ggtaaaaagaagtga

DBGET integrated database retrieval system